KEGG   Ustilago maydis: UMAG_00138Help
Entry
UMAG_00138        CDS       T01021                                 

Definition
(RefSeq) putative translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
uma  Ustilago maydis
Brite
KEGG Orthology (KO) [BR:uma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:uma03012]
    UMAG_00138
   03029 Mitochondrial biogenesis [BR:uma03029]
    UMAG_00138
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uma04147]
    UMAG_00138
Translation factors [BR:uma03012]
 Eukaryotic Type
  Elongation factors
   UMAG_00138
 Prokaryotic Type
   UMAG_00138
Mitochondrial biogenesis [BR:uma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    UMAG_00138
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UMAG_00138
  Exosomal proteins of breast cancer cells
   UMAG_00138
  Exosomal proteins of colorectal cancer cells
   UMAG_00138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 23561526
NCBI-ProteinID: XP_011386092
UniProt: A0A0D1CZK5
LinkDB All DBs
Position
1
AA seq 470 aa AA seqDB search
MSLLRTQASRFVVRPLATNKVVAAAPAAARTFVTRPSTNPASTLAGRARVCAAPLPRIAI
ASQVRTYAAESGKFERTKPHMNIGTIGHVDHGKTTLTAAITKTLHEAQGTGKFIDYASID
KAPEERARGITISTAHVEYETGNRHYAHVDCPGHADYIRNMITGAAQMDGAIIVVSAPDG
QMPQTREHLLLAKQVGIKKLVVFINKVDQIDDPEMLELVEMEMRDLLSTYGFDGENTPFV
SGSALAALESRDPEVGQQAILKLMEETDKWLDLPPRDLEKPFLMPVEDVFSIPGRGTVVT
GRVERGTIQKGAEVEILGLGNTFKTTLTGIEMFHKQLDQGMAGDNMGALLRGVKREQVKR
GQVMVIPGSIKPVKKFRAQVYILKKEEGGRYTPFMNNYRPQLFIRTADVTVSLTHPPGTE
DADEKMVMPGDNVELDGELVHDIALEEGSRFTLREGGKTVGTGIVTKIHA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctccgaactcaggcttctcgcttcgtcgtcaggccgctggccaccaacaag
gtggttgccgccgctcccgctgctgcccgcacctttgttactcgcccttccaccaaccct
gcctccaccctcgcaggccgtgctcgagtatgcgctgctccccttccccgcatcgccatc
gcctcgcaggtgcgaacttatgctgctgagtcgggcaagttcgaacgtaccaagccgcac
atgaacatcggtaccattggccacgtcgatcacggaaagactactctcaccgccgccatc
acaaagaccctccacgaggctcagggcaccggcaaattcatcgactatgcctccattgac
aaggcgcctgaagagcgcgctcgtggtattaccatctccaccgcccacgtcgagtacgag
acgggcaaccgccactacgcccacgtcgactgccccggtcacgccgattacattcgtaac
atgattaccggtgccgctcagatggacggtgccatcatcgtcgtctcggcccccgatggc
cagatgcctcaaacgcgtgagcatcttttgctcgccaagcaagtcggtatcaagaagctt
gtcgtcttcatcaacaaggtcgaccagatcgacgacccagagatgctcgagcttgtcgag
atggagatgcgcgatcttctctccacctacggctttgacggcgaaaacactcccttcgtc
tctggctcagcccttgcggcccttgagagccgtgaccccgaagtcggccaacaggctatc
cttaagctcatggaagagaccgacaagtggctcgaccttccccctcgtgatctcgagaag
cctttcctcatgcccgtcgaggacgtcttctctatccccggtcgtggcactgtcgtcacc
ggtcgtgttgagcgtggtaccatccagaagggtgccgaagttgagatcctcggtctcggc
aacaccttcaagaccacccttactggtatcgaaatgttccacaagcagctcgaccagggt
atggccggtgacaacatgggtgccttgctgcgtggtgtcaagcgagagcaggtcaagcgt
ggtcaggtcatggtcatcccaggctctatcaagcctgtcaagaagttccgtgctcaggtc
tacattctcaagaaggaggagggcggtcgatacacccccttcatgaacaactaccgacct
cagctctttatccgaaccgccgatgtcactgtttcgctcactcaccctcccggaaccgag
gacgccgacgagaagatggtcatgcccggtgacaatgtcgagctcgacggtgagctcgtt
cacgacattgcccttgaggagggttcgcgattcaccctccgtgaaggtggtaagaccgtc
ggtaccggtatcgtgaccaagattcacgcctaa

DBGET integrated database retrieval system