KEGG   Ustilago maydis: UMAG_01172Help
Entry
UMAG_01172        CDS       T01021                                 

Definition
(RefSeq) putative succinate dehydrogenase flavoprotein subunit SDH1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
uma  Ustilago maydis
Pathway
uma00020  Citrate cycle (TCA cycle)
uma00190  Oxidative phosphorylation
uma01100  Metabolic pathways
uma01110  Biosynthesis of secondary metabolites
uma01130  Biosynthesis of antibiotics
uma01200  Carbon metabolism
Module
uma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
uma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
uma_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UMAG_01172
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UMAG_01172
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UMAG_01172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 FAD_binding_3 Pyr_redox_2 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 23562270
NCBI-ProteinID: XP_011387114
UniProt: A0A0D1CDW6
LinkDB All DBs
Position
2
AA seq 654 aa AA seqDB search
MIFARSLSRAVARAPSSSSLVTPSHRVAGFHSTPKASRIIASQPLRAKEAATPLDAAKGY
PVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMT
EDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTKDGKIYQRAFGG
QSLNYGKGGQAYRCAAAADRTGHAMLHTLYGQSLRHNTNFFIEYFALDLIMEDGECVGVT
ALNMEDGTIHRFRAHKTVLATGGYGRAYFSATSAHTCTGDGMAMVSRAGLPLQDLEFVQF
HPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGR
GVGPEKDHIYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPT
KYTGEVITKGPNGEDKIVPGLYAAGETACVSVHGANRLGANSLLDIVVFGRACANHIKEN
LDPGKPHKELKGDAGAKSINDLDWVRNANGTKTTADIRNDMQRVMQSDAAVFRTQKTLDE
GVEKIDKVYSTFPDVSIQDRSMIWNSDLVETLELKNLLTCATQTMHSAAARKESRGAHAR
EDYPDRDDEQWMRHTLSWQHEGTGDKVKLDYRGVISTTLDEAECKPVPPFKRQY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgcaaggtcgctctcgcgcgccgttgcgcgtgcgccttcttcctctagcctt
gtcaccccttcgcaccgagtcgctggcttccactccacccccaaggcatcgcgcatcatt
gcttctcagcctctccgtgctaaggaggccgccaccccacttgacgccgccaagggttac
cctgtcattgaccatgagtacgatgctatcgttgtcggtgccggtggctctggtctccgt
gccgccttcggtcttgctgaggccggtctcaacactgcttgtatcaccaagctcttccct
acccgttcgcacaccgttgccgcccagggcggtatcaacgccgcgcttggaaacatgacc
gaggatgactggcggtggcacatgtacgacactgtcaagggctccgactggctcggtgac
caggacgccattcactacatgtgtcgtgaggctccgcgtactgttattgagctcgagcac
ttcggtctccccttctcccgaaccaaggacggcaagatctaccagcgagctttcggtggt
cagtcgctcaactacggcaagggtggtcaggcgtaccgatgtgccgctgccgctgaccga
actggtcacgccatgctgcacaccctgtatggtcagtcgcttcgacacaacacaaacttc
tttatcgagtactttgccctcgacttgatcatggaggacggcgagtgcgtcggtgttact
gcactcaacatggaggacggcaccattcaccgcttccgtgctcacaagaccgttcttgcc
accggtggttacggacgtgcttacttctctgccacttcggctcacacgtgcactggtgac
ggtatggctatggtctcgcgtgctgggcttcccctgcaagatctcgagttcgttcagttc
caccctaccggtatctacggtgctggttgcttgatcaccgagggttcgcgtggtgagggt
ggttacctgctcaactcggagggtgagcgattcatggagcgatatgctcctaccgccaag
gatcttgcctcgcgtgacgttgtctcgcgttccatgactatcgagatccgtgagggccgt
ggtgttggccccgagaaggatcacatctacctgcagctctcgcacttgccgcccgaggtt
ctccacgagcgtctccctggtatctcggagaccgccgccatctttgccggtgttgatgtc
accaaggagcctattcctgtgcttcctacggtgcactacaacatgggtggtatccccacc
aagtacaccggtgaggtgatcaccaagggccccaacggcgaggacaagatcgttcctggt
ctctatgccgccggtgagactgcatgtgtgtcggtgcatggcgctaaccgtctgggtgcc
aactcgttgcttgacattgtcgtctttggtcgtgcttgtgccaaccacatcaaggagaac
ctcgatcccggtaagccgcacaaggagctcaagggtgacgcgggtgccaagtcaatcaac
gacctcgactgggtgcgaaacgccaacggcaccaagaccaccgctgatatccgcaacgac
atgcagcgtgtcatgcagtctgacgccgctgtgttccgtacgcagaagacgctcgacgag
ggtgtcgagaagatcgacaaggtgtactcgaccttccccgatgtctcgattcaggaccgc
tccatgatctggaactcggatctggttgaaacgctcgagctcaagaacctgctgacctgc
gcaactcagaccatgcactcggctgctgcccgaaaggagtcaaggggtgctcatgctcgt
gaggactaccctgaccgagatgacgagcaatggatgcgtcacactctgtcctggcagcac
gagggcaccggcgacaaggtcaagctcgactaccgaggtgtcattagcacgaccctcgat
gaggccgagtgcaagcccgttccccccttcaagcgccagtactga

DBGET integrated database retrieval system