KEGG   Ustilago maydis: UMAG_01870Help
Entry
UMAG_01870        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
Organism
uma  Ustilago maydis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_N_4 VHL
Motif
Other DBs
NCBI-GeneID: 23562754
NCBI-ProteinID: XP_011387808
UniProt: A0A0D1E3K8
LinkDB All DBs
Position
3
AA seq 277 aa AA seqDB search
MSKPAPGHKDAVYHTQCTGQALETVKTHSSPAEQTLFGACFCPFVHRVWIALEYLGVPYQ
YREVDPYKKLADLLELNPKGLVPALKLSNGKGLAESSVILEYIDEKYGGGKEGKSLLPPL
SNPYERAVYRLAVDKANRNLIPSFYRYLQAQEVEKQLEGAKEFTSHLSDFVRSMSSSGSV
GFWDGKALSIVDCTVAPWLYRATNVLRHFRGFEPEQLLEPDVMERWTKWRDAVFDLDAFK
ATTSTDDLYLDSYVRYAQNRPMTSQVAEAINKGRGLP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagccagcaccaggtcacaaggatgccgtctaccatacccagtgcacgggacag
gcgcttgagacggtgaaaactcattcgtctccagcggagcagactttgttcggagcctgt
ttttgtccattcgtgcatcgggtatggatcgctcttgaatatcttggagtgccttaccag
tatcgcgaggtcgatccctacaagaaactagcagatctgcttgagctgaatcctaaaggt
ctcgtaccagcgctcaagctatcgaatggcaaaggcttagccgagtccagcgtgatcttg
gagtacatcgacgagaagtatggtggaggtaaagaaggcaagtcgctgctgccccccttg
tctaatccatacgagcgagccgtctaccgcctagcagtcgacaaggcgaatcgaaatctc
attccttccttctaccgctatctgcaggcgcaagaagtcgaaaagcagctcgaaggagcc
aaagaattcacatcgcacctgagcgactttgtacgttccatgtcgtcctctggctcggta
ggcttttgggacggcaaggcgctttccattgtcgactgcacggtagctccttggctgtat
cgagcgaccaatgtgctgcgacactttcgaggctttgagcccgaacagctacttgagccc
gatgtaatggagagatggactaagtggagagacgccgtctttgatctcgacgctttcaag
gctaccacttcgacagacgatctatacctcgactcgtatgtgcgctacgctcagaaccgc
cccatgacgtcccaggtggccgaggcaattaacaagggtcgaggccttccttga

DBGET integrated database retrieval system