KEGG   Ustilago maydis: UMAG_02740Help
Entry
UMAG_02740        CDS       T01021                                 

Definition
(RefSeq) putative Alpha-glucosidase precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
uma  Ustilago maydis
Pathway
uma00052  Galactose metabolism
uma00500  Starch and sucrose metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UMAG_02740
   00500 Starch and sucrose metabolism
    UMAG_02740
Enzymes [BR:uma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     UMAG_02740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 YwpF
Motif
Other DBs
NCBI-GeneID: 23563412
NCBI-ProteinID: XP_011389102
UniProt: A0A0D1DZF9
LinkDB All DBs
Position
6
AA seq 1035 aa AA seqDB search
MRSFKVLTPLVAAVFTTSFCLTSALPSSIVDHQLETSAVQRRDDNNDSYISPSFDVTQCP
GYRLVGGPVQSQYGFTAKLSLAGQACNAYGVDIADLTLSVVYEKKHQLHVHIYDTAKHQY
QLPNGLIYDRPSDDPAEIQDGVTAENSDLVFHHTAENDRQSDGSWAFWITRKSNDEVIFD
TRPTNIPTYEQGMSNVASDTKRNSTAMPKHELIFENQYLQLSSALPEDANVYGLGEYVSR
SFRRDPDETLQPFFTLDAGTPVDSNMYGYHPVYTEARRGADGKLRTHTVSFTSTSGMDVL
LRRGLIQYRAIGGTMDLRFFSGSSNGRNSPNSAIQQYVNFIGNPVLHPYWAYGFHLCRWG
YTNVSDTQAIIDAMREHNIPLEVQWNDIDYLQEFRDFTTDPQRFAQSEFAEMIRKLRDNH
QHYVPIIDMAIPKAPTNASDTYYPGTRGDELDVFLKNRNHTEYIGEVWPGYTSFVDQQAE
NAAQWWTEAIRNFSEIVDFSGIWLDMNEPSSFVIGNAAGVETNLSDTPAYTAATSVAGWP
QGYDNLTWGSSGNVTVNGSYTFQEGVQNNDAEQRRRSLLVRREHDSVLPKRQDRDQGNKF
GSHDPHYRYANASVRYLSNPPYAIHNGIHISETDLNVNLDKKTVAMDAVSADGSRAVYDV
HNLDGTLEEQHFYKALRTIRPNERPFLISRSTYPGAGRYTGHWLGDNYALWTILPGQQAY
KAGAGMAQSIDGVLQFQMFGIHFIGADICGFNRNTDEELCNRWMMLGAFLPFMRNHNTIG
AIAQEPFRWDSVANASRIAISKRYELLPSLYSHMARSSASGEPAIRAIWYEFDEVFEQTN
HYAHQFLFGDNLLVSPVLEPNVTHVNALFPRAGGSWRNVFDWTALDVEPNKHVAVNAPLC
TINVHLRPGRALLTHSMPAYTVHETAQSAYALIVNLNNQASASQSFYLDDTTTPAPSPNS
TLTVHACNNTIHINLQGSYLPIQPLSYIVVLNVNHQPHRVTANSSSTSFLWDPKRSLLNI
TNLAIPLTQSVIHWS
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcgttcaaagtgctgacgccgctggtggctgctgttttcaccacctcgttttgc
ttaacctctgcgcttccgtcgtcgattgtcgaccaccagctcgagacgagcgccgtccaa
aggcgtgatgacaacaacgactcttacatctctccttcctttgatgtgacccaatgccct
ggctaccggcttgtcggcggaccggtacagtcgcagtatggctttaccgctaagcttagc
ctggcaggccaagcgtgcaatgcttacggagtcgacattgccgatttgactttgtcagtc
gtgtacgagaagaagcatcagctccacgtgcacatctacgacacggcgaaacaccagtat
cagctacccaacggtctcatttacgaccggccgtcggacgacccggctgagattcaggat
ggcgttaccgctgagaacagcgaccttgttttccaccacacggcagagaacgataggcaa
tcggatggcagctgggccttttggatcactcgcaagtcgaatgacgaggtcatctttgac
acgcgccccaccaacatccctacctacgagcaggggatgagtaacgtcgccagcgacacg
aagcgaaactcgacggctatgcccaagcacgagctgatcttcgagaaccagtatttgcag
ctctcgtcagctctgcctgaggatgcgaatgtgtatgggttgggagagtacgtgtcgaga
agctttcgacgcgatccggatgagacgctgcagccgtttttcacgctggatgcgggcacg
ccggttgactcaaacatgtacggataccatccagtgtacaccgaggcgcgacgcggtgct
gacggaaagctcagaacgcatacagtgtcgtttacgagcacgagcggaatggacgtgctg
cttcgacgcgggctcatccaataccgtgctataggaggcacgatggatctgcgatttttt
tcgggttcttccaacggacgcaacagcccgaactctgctattcagcagtacgtcaacttt
atcggcaacccggtgctgcatccttactgggcgtacgggttccatctgtgtcgatggggc
tacacgaacgtctctgacacccaggcgattatcgatgctatgcgcgagcacaatatccct
ctcgaggtgcagtggaacgacattgactacctgcaagagtttcgcgatttcacgaccgat
ccccagcgctttgcgcaatccgaattcgccgaaatgatccgcaagcttcgcgacaaccac
cagcactacgtgccgatcattgacatggcgattcccaaagcgccgaccaacgccagcgac
acgtactacccaggaacgcgtggtgacgagctcgacgtcttcctcaagaaccgaaatcac
accgagtacattggagaagtgtggcccggctacacgagctttgtcgatcaacaggccgag
aatgcggcgcagtggtggaccgaggccatccgaaactttagcgagatcgtcgacttctca
ggcatctggttggacatgaacgagccttcgagctttgtaatcggtaatgcggcaggtgtc
gagacgaatctgtcggatacaccggcgtatactgcggcgacaagtgtcgccggttggccg
caagggtacgacaatctcacgtggggaagctccggtaacgtgacggtcaacggcagctat
acgttccaggagggcgtgcagaacaacgatgccgagcagaggcggcgttcgcttctggtg
cgtcgcgagcacgattctgttctgccaaaacgtcaagacagggatcagggcaataagttc
ggttcacacgatccgcattatcgatacgccaacgcatcggtgcgatacctctcgaacccc
ccgtatgcaatccacaacggaatccacatcagcgagacggacctgaatgtgaatctggac
aaaaaaacggtagctatggacgcggtaagcgccgacggttcgcgcgccgtctacgacgtc
cacaacctcgatgggacgttggaggaacagcatttctacaaggcactgcggacgattcga
cccaacgaacggccgttccttatctcgcgctccacgtaccctggagccggaagatacacc
gggcattggttaggtgacaactatgcgctatggaccatcttaccaggtcagcaggcgtac
aaggcgggcgcgggcatggcgcagtcgattgacggcgtgttgcagttccagatgtttgga
atccattttatcggcgctgatatttgcggtttcaataggaacacggacgaagagctttgc
aatcgatggatgatgcttggcgcgtttttgccgttcatgcgcaatcacaatacgatcggg
gcgatcgcgcaggaaccgttccgatgggacagtgtcgcgaatgcttcgcggattgctatc
agcaagaggtacgagttgctgcccagcttgtactcgcacatggcgaggtcgagcgctagt
ggcgagccggcaattcgcgccatatggtacgagttcgatgaggtatttgaacagaccaac
cactacgcgcaccagttcttgttcggagacaacctcttggtgagtccggtattggagccg
aatgtgacacatgtcaatgcgctctttccacgcgccggcggaagctggcgaaacgtgttt
gattggacggcgttggatgtagagcccaacaaacacgtcgctgtcaacgcaccgttatgt
acgatcaatgtgcatcttcgaccgggtcgcgctctgctgactcactcaatgcccgcatac
acggtgcacgaaaccgcacagtccgcctacgcgctcatcgtcaacctcaacaaccaagcc
tcggcaagccagtcgttctacctcgacgacactacgacacccgcccccagccccaactcc
accctcaccgtccacgcttgcaacaacactatccacatcaacctacaaggctcctacctc
cccatccagccgctttcctacatcgtcgtcctcaacgtcaatcatcaaccccaccgcgtc
accgccaactcctcctccacctctttcctctgggatcccaagaggtccttgctcaacatc
actaacctagccatccccctcacccaatccgtcatccactggtcctga

DBGET integrated database retrieval system