KEGG   Ustilago maydis: UMAG_03085Help
Entry
UMAG_03085        CDS       T01021                                 

Definition
(RefSeq) putative manganese superoxide dismutase precursor (sod-2)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
uma  Ustilago maydis
Pathway
uma04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:uma00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UMAG_03085
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UMAG_03085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N CAS_C
Motif
Other DBs
NCBI-GeneID: 23563656
NCBI-ProteinID: XP_011389446
UniProt: A0A0D1C658
LinkDB All DBs
Position
7
AA seq 206 aa AA seqDB search
MSEHTLPQLPYGYNELEPAISEEIMTIHHTKHHQLYVTNLNNAIKAYNSAISSNDVRKQI
ELQSAIKFNGGGHINHSLFWKNLAPASQGGGQLQDGPFKQAVERDFGSLDNLKSTFNATI
ATIQGSGWGWLGFNPKNSKLEVVTTKDQDPLISHHPIIGVDAWEHAFYLQYKNVKADYFK
NIWSVINFKEAEERFKAAQTDAKARV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcacacccttccccagctcccttacggctacaatgagctcgagcccgccatc
tcggaggagatcatgaccatccaccacaccaagcaccaccagctttacgtcaccaatctc
aacaacgctatcaaggcctacaactcggccatctcgagcaacgacgttcgcaagcagatt
gagctccagagcgccatcaagttcaacggcggtggccacattaaccactcgctcttctgg
aagaaccttgctcctgccagccagggcggtggacagcttcaagatggtcccttcaagcag
gccgtcgaacgtgactttggctcgctcgacaacctcaaatccaccttcaacgctaccatt
gccaccatccagggctctggttggggctggctcggtttcaaccccaagaactcgaagctt
gaggttgtcaccaccaaggaccaggaccctctgatctcgcaccaccccatcatcggtgtc
gacgcttgggagcacgctttctacctccagtacaagaatgttaaggctgactacttcaag
aacatttggtcggtcatcaacttcaaggaggccgaggagcgcttcaaggctgcccagact
gacgccaaggctcgtgtttaa

DBGET integrated database retrieval system