KEGG   Ustilago maydis: UMAG_04064Help
Entry
UMAG_04064        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
uma  Ustilago maydis
Pathway
uma00500  Starch and sucrose metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UMAG_04064
Enzymes [BR:uma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     UMAG_04064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 23564350
NCBI-ProteinID: XP_011390503
UniProt: A0A0D1CMZ0
LinkDB All DBs
Position
11
AA seq 547 aa AA seqDB search
MTTNMDTLESKRAATESTPLLCSTHASHKCASYPWLAQGADSEDMTRSTESRVARIRIAL
LSSGGLCLLLIWFCALSSNVDAAWIVKLVIGQQSSARASHLASRSVSSTYAYQRMLANIG
GASSTVGDNQVPNVETGAVIASPSTAHPDYLYSWVRDAALTIKVVISQPTLDRTLVTNYA
NAEYTHQQNAARSAAGQGEPKFNVDGSLFTGAWGRPQNDGAALRASALMAFAKRIGLNDS
FTTGTLYKRELGSPSLIKTDLEYVAHHWQDSSFDLWEEVEGAHFFTLIVQWRSMVDGAKF
ASAINDAGAASYYDQQAAEMLVKLQSFWDADKGYVQAYQGVGNRDGIDCSVLLGSLKGWD
TTDYNAAVNATLFGPASDKVLATHKKYVDAFRSMYAINGGAAAPAAVATGRYPSDVYDGD
GTSQANPWYICTLAAAEVLNTALSIVRARGSLEITSTSLAFYRQFASSATTGSFSSTSDQ
YITLTTAIKRMADGFVQIVNQHAWHNGSLNEQFNRNTGFNQGARDLTWSYAAFVTNDWAS
HNMFLVT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaacatggacacgctcgagagcaaaagagccgctactgaatcgacgcctctt
ctgtgctcgacgcatgcatcccataaatgtgcctcctacccctggcttgcacaaggcgcc
gatagtgaagacatgactcgttcgaccgaatcgcgtgtcgcgcgcatccgcatcgctctg
cttagcagtggcggtctgtgcctactgctcatctggttctgcgcgttgagcagcaatgtt
gacgcggcttggatagtcaagttggtgatcgggcaacagtctagcgctcgtgcttcacac
ctcgcttcacgttctgtcagttcgacgtacgcgtaccagcgtatgttggccaacatcgga
ggtgcctcgtccacggtcggcgacaatcaagtgcctaacgtcgaaacgggcgctgtgatc
gcctcgccttccactgcacatcccgactacttgtactcgtgggtgcgcgatgcagctctc
accatcaaggtggtcatctcacagccgacactcgaccgaacgctggtgaccaactatgcc
aatgccgaatacacgcaccagcaaaacgcagccagatcggctgcaggccaaggcgaaccc
aagttcaacgtcgacggttcgctcttcacgggtgcatggggaagacctcagaacgacggc
gctgcgttgcgcgcttcggctctgatggcgttcgctaagcgcatcggcctgaacgacagc
ttcacaacaggtacactgtacaaacgcgagctaggctcgcccagcttgatcaagaccgac
ctcgagtacgtggcgcaccactggcaggattcgagctttgatttgtgggaggaagtggag
ggtgcccactttttcacactcatcgtacagtggaggagtatggtggatggcgccaagttt
gcaagtgcgatcaacgatgcgggtgcggcgagctactacgaccaacaggcggcggaaatg
ctggtcaagctgcagtcgttctgggatgcagacaagggttatgtgcaggcgtaccaaggt
gttggcaacagagatgggatcgactgttccgtgctgcttggctcactcaaggggtgggat
acaacagactacaacgcagctgtcaacgcgacgcttttcggacccgcttcggacaaagta
ctggcaacacacaaaaagtatgtggatgcattccgatcaatgtacgcgatcaacggcggc
gctgctgctcctgcagcggtggccacagggcgctacccatcagatgtctacgacggcgat
ggaacgtcgcaagccaacccgtggtacatctgtacgctcgctgctgccgaagtgctgaat
acggcgctcagcatcgttcgcgctcgtggcagtctggaaatcacctcaacttcgctggcg
ttctaccggcagttcgcctcgtcggccactacaggaagcttctcctcgacctcggatcag
tacatcaccctcactaccgccatcaagcgtatggctgatggatttgtgcagatcgtcaac
cagcacgcttggcacaacggcagcttgaacgaacagttcaaccgcaacaccggcttcaac
cagggcgccagagatttgacctggtcctacgccgcattcgtcacaaacgactgggcaagt
cacaacatgttcctcgtaacctag

DBGET integrated database retrieval system