KEGG   Ustilago maydis: UMAG_04114Help
Entry
UMAG_04114        CDS       T01021                                 

Definition
(RefSeq) putative repressible alkaline phosphatase vacuolar
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
uma  Ustilago maydis
Pathway
uma00730  Thiamine metabolism
uma00790  Folate biosynthesis
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    UMAG_04114
   00790 Folate biosynthesis
    UMAG_04114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uma04147]
    UMAG_04114
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uma00537]
    UMAG_04114
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UMAG_04114
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMAG_04114
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uma00537]
 Enzymes
  UMAG_04114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 23564386
NCBI-ProteinID: XP_011390615
UniProt: A0A0D1C194
LinkDB All DBs
Position
12
AA seq 591 aa AA seqDB search
MQLQGLFAQLGALMLVALAASAAPNNGAKWQHKKQPNVIQLISDGFGPASETFARSYLQS
SKKLGWNVTMPLDRLLVGEVRTRSTNSLVTDSAASATAYSCGLKSVNAYIGVDSDKKPCG
TVLEGAKAKGYNTALVTTSRITHATPASYSAHIDDRDAEDEIASQQIGDYVLGRQVDILW
GGGLRHFLPNTTKPGIRTDSRNLVQEAKQRGFHIINNRTDFDALQAGNALKLPSLALFAS
SHMAYEIDRNATQEPSLKEMALTALNGLRNQDEPYFIMIEGARIDHAAHNNDPIGHIHDI
LAYNDMVQAVVDWVDANAAANPHEPETVVFSVADHECGGLTLGLQRSEDEESFYGWYPDV
LLNATHSTEFLAAQTAKWIAAANRTDDELSTYIRDNVVSTGLGIKDVQKDEVERAVQLAK
LKNQIPYTVWLSSIVNWRAHLGWSTTGHSGVSVGLYYHEAKPHKVGTPKYKRYQQRRSSV
IGSHENTWIGEWIASFLELDLASITKTLNNGSDYSWYSNWGDKLNHFTDTLEHYHGGLAR
VIPARSASEKRDLHAADSHLLNEPLMRRIHGPRVGATLEESWHTSARRQQL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttcaaggattgttcgctcaacttggagcgctcatgcttgtggcgctggccgcc
agtgccgccccgaacaacggcgccaagtggcagcacaagaaacagcccaacgtgatccag
ctcatctcggacgggtttggaccggcttccgagacgtttgctcgctcgtacctgcagagc
tccaagaaactgggctggaacgtaaccatgccgctcgacaggctgctggtgggcgaggtg
cgaacacgatcgaccaactcgttggtgaccgactcggctgcttcggcaaccgcgtattcg
tgcggcctgaagagcgtcaacgcatacattggtgtggattccgacaaaaagccgtgcggt
acggtgcttgaaggagccaaggcgaaaggatacaatacggcgctcgttactacgtcgcgc
atcacgcacgcgacgcccgcttcgtactcggcgcacatcgacgaccgtgatgctgaagac
gagatcgccagccagcagatcggcgactacgtgcttggccgccaggtcgacatcctgtgg
ggtggcggactgcgtcactttttgcctaacaccaccaagccaggtatccgtaccgacagc
cgtaacctcgtccaagaggccaagcagcgcggatttcacattatcaacaaccgcaccgac
tttgacgccctccaagccggcaatgcgctgaaactgccctcgctggcgctcttcgcttcg
tcgcacatggcgtacgagatcgaccgaaacgcaacgcaggaacccagcttgaaggagatg
gccttgaccgcgctcaacggcttgcgcaaccaggacgagccgtactttatcatgatcgag
ggcgcgcgcatcgaccatgctgcacacaacaatgaccccattggtcacattcacgatatc
ctcgcgtacaacgacatggtccaggcggtggtcgactgggttgacgccaacgcagccgcc
aacccgcacgagcccgagacggtggtgttttcagtcgccgaccacgagtgcggtgggctg
acgctcggtctacagaggagtgaggatgaggagtcgttctacggatggtacccggacgtg
ctcttgaacgctacgcattcgaccgagttcctggcggctcagaccgccaagtggattgcc
gctgccaaccgtaccgatgacgagctgagcacctacatccgcgacaacgtggtttccacc
ggcctcggcatcaaggatgttcagaaggacgaggtggagcgtgccgtccaactagccaag
ctcaagaatcagatcccctacaccgtctggctatcgtcgatcgtcaactggcgcgcacac
ctcggatggtccacgacgggccactctggtgtctcggtcggtctatattaccacgaagcc
aaaccgcacaaggtgggtacacccaagtacaagcgataccagcagcgtcgatcttcggtg
atcggatcgcacgaaaacacgtggatcggcgagtggatcgcgtcgttcctcgagctcgat
ctggcgtcgatcaccaagacgctcaacaacggcagtgactacagctggtacagcaactgg
ggcgacaagctaaaccactttaccgataccttggagcactaccatggcggactggcgcgc
gtcatcccggctcgatccgcgagcgagaagcgcgatctgcacgccgccgactcgcacctg
ctcaacgagccactcatgagacgtattcacggccctcgtgtgggcgcgacactcgaagag
tcttggcacacctcggctcgtcgtcagcagctctga

DBGET integrated database retrieval system