KEGG   Ustilago maydis: UMAG_10914Help
Entry
UMAG_10914        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
Organism
uma  Ustilago maydis
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 23566876
NCBI-ProteinID: XP_011391548
UniProt: A0A0D1BYN7
LinkDB All DBs
Position
16
AA seq 1132 aa AA seqDB search
MDYVAAPPTGVLPGTSSTRAVRTAASTTSAQSAAELDILLAPSVLKHRYVRGVDKSLIVE
RPERIRAVLLGIATAIGKSSSEQPHDPTMALHTSQRSPSKAPSQQQNTIHLASSIDSSVA
RTTTHVSCAPLPANTPSQQDQDDDLVARLSSLSVQATAAQHPTSPAQQKFRVLHSTRSLP
LDPPHPAVAFTHAHSDEVVSLLETAYGQARQKRREARTATSTCTQASDALIDASQFKPER
ETTPTPASVAAGPPSQQQAASSLSPARTSHAAYLEYLCNKAPNHPPQSHRKPHQTSPSKS
IPEDSETYTSSDGEGDDAMHLSEVPEHLPQGDLYLAGPSDQSGMDGGSAEAIRHAMGACC
EAVDRVVSAAASTTMASPTLSPLREIKVQDSTHLNVTESLASNDDNETAPAAKRAFVLSR
PPGHHCSGSTPQGFCWVNNAIVAAAHAYHEHSIDRVVIFDIDLHHGNGTQNLAWRINADA
NKHDDQRTERIASLRVAALERARQALGSGSGRAHASRLAKVALTEHDEAEVKRQAGPRAL
RLFYSSLHDIESFPCEDGDPGMIKDASTCVEGAHGQWIWNIHLDHYRTESDFRRLYDDKY
KIVFSKAARFLGATCATQQNTLVLISAGFDACAYEYPGMQRHGKHVPPSFYHMFARDAVH
FADAHADGKLVSVLEGGYSDRALCSAALAHVTGLAVRVDSAASSVVGGEAETEYWKLENL
IAVEKVAKKMAAHAAAAVSGAAPSTNTTPKRRQAELAPWLSLTSKAFAAFEQACGKGNVV
PLGIGATPSTRSSATTNTTNSPAIGAGGRVLRDRGALRTRPGAWESATSTPHARRAASPT
KTAGRKDSPIKKESPSSVTSVGGVVDASATPVMADTQRGLVDDSMSMDTDTPTKSVTSDA
RVRSLRLPSPLKSIHQSNDNRVRKSDVEADQQRQANSTDPTIAPTQVDPSVPAAPVDTNT
STFPSALSTYGNAVSTDAEVAASPSIEDTINASTTLRSRTLSSAHASLVDTSFLAHAPMH
VDAADTHASSDSLGQLYDNGDSWIHQHSLLGGEPDAPGSPDWSAAHACVPSTYQGEPETQ
APATLGTAVTSSEFTGAAGVENQASRQHQAPVSSSSSLYPDLASCHLAHPTQ
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggactatgtcgctgcaccaccaacaggcgttctgcccggtacgagctcaactcgcgct
gtgcggactgctgcaagtacaacttcagcgcaatctgcggcagagctggatatattgctg
gctccctccgtactgaaacacagatacgtgcgcggtgtagacaagagcctgatcgtcgaa
cgaccagagcgtatccgcgcagtgctcctcggaatcgcaacagctatcggcaagtcgtcg
tccgaacagccgcatgatcctaccatggctcttcacacatcccaacgttctccatctaaa
gctccttcgcaacagcagaacacgatccatctagcgagctcgattgattcatccgtagcc
agaacgaccacgcatgtctcttgcgcaccactcccagccaacacgccatctcaacaagac
caagatgacgatctggtagctcgactcagttcgctttccgtgcaggctaccgcagctcaa
catcccacctctccggcccagcaaaagttccgtgtgcttcattcgacaagatctcttccg
ctggatccaccccatcctgccgtagcttttacccatgcacactcggacgaagtcgtctcg
ctgctcgaaaccgcttacggtcaagccagacagaaacgtcgcgaggcacgcacagcgacc
tcgacttgcacgcaagcctctgatgccttaatagatgcaagtcagttcaagcccgaacgt
gagactacgcctacacctgcgtccgtcgcggctggtccgccatcacaacagcaagccgcc
tcttctctttctccagcgcgtacgtcccacgctgcgtacctcgaatacctctgtaacaaa
gcacctaatcatccaccgcagtctcaccgcaaacctcaccaaacctcaccttcaaaatcg
atacccgaggacagcgagacctacacttcgagcgatggcgagggtgacgatgcaatgcat
ctctccgaggttcctgagcacttgccccaaggtgatctgtaccttgcaggcccctctgac
caatctgggatggatggtggatctgcagaggcaattcgacacgccatgggtgcctgctgc
gaagccgtagaccgtgttgtgtcagcagcagcatctacgaccatggcatcaccaacattg
tctcctcttcgtgagatcaaggtccaagactcgacccacttaaacgtcacggaaagcctt
gcatcgaacgatgataacgaaacagctccggccgccaaacgtgcattcgttcttagccgg
ccgcctgggcaccactgctccggatcaacaccacaaggtttctgctgggtcaacaatgca
atcgtcgccgcagcgcacgcttaccacgaacacagcatcgatcgcgtcgtcatatttgat
attgacctgcatcacggtaacggcacgcagaacctggcatggcgaatcaatgccgacgcc
aacaaacacgatgatcagcgcaccgagcgtatcgccagcctgcgtgtggctgcgctcgaa
agggcaagacaggcactcggaagcggcagcggtcgcgcacatgccagcaggctcgccaaa
gtagcgctgaccgaacacgacgaagccgaggtgaaacgccaagcgggtccacgagcgctg
agactcttctacagctcgttgcacgacattgaatccttcccttgtgaagacggcgatcca
ggaatgatcaaggatgcaagcacgtgtgtcgaaggcgcacacggtcagtggatctggaat
attcacctggatcactatcgaactgaatccgacttccgtcggctgtacgacgacaagtac
aagatcgtgttcagcaaagccgcgcggttcctcggcgcgacatgtgctacacagcaaaac
acgctcgttctcatatcagcaggattcgatgcgtgtgcgtacgaatatcccggcatgcaa
cgtcacggaaagcacgtcccaccttcgttctaccacatgtttgcgcgcgacgctgtgcat
ttcgccgatgcacacgcagacggaaagctcgtctcggtactcgaaggcggatacagcgat
cgtgcgttgtgttcagccgcactggcacacgttactggtctcgctgtgcgtgtcgattca
gcagcaagttcggtcgtaggaggcgaggcggagaccgagtattggaaattggagaatctg
atcgcggtcgaaaaggtggccaagaagatggcggctcacgctgctgctgcagtgtcgggt
gcggcacccagcaccaacacgacgcccaaacggagacaagccgaattggcaccttggctg
tcgctcacttccaaggcgtttgctgctttcgaacaggcgtgcggcaaaggtaacgttgtt
ccgctgggaatcggtgctacgccgtcgacgaggtcgtccgcgacgacaaacacgaccaac
agtccagcgataggtgcaggtgggagagtgttgcgagatcgaggcgctttgaggacgcgt
cccggtgcgtgggagagcgcgacatcgacaccacacgcgaggcgcgccgcaagcccgacc
aagacagcgggaagaaaggacagcccgatcaagaaggagtcgccgtcgagcgtgacaagt
gtcggcggtgtggtcgacgcttctgcgacgccagtcatggcggatacacagcggggcttg
gtggatgattccatgtcgatggatacggatacgccgacaaaatctgttacgagtgatgca
cgtgtgcgatcgttgcgcttgccatcgcctctcaagtctattcaccagtccaatgacaat
cgtgtgcgcaaatcggatgtcgaagccgatcagcagcgccaagctaacagtacggatcct
accatcgctccaacccaagtcgacccaagcgtacctgccgcaccggtcgacaccaacacc
tctacctttcctagtgctttgtcaacgtatggcaacgctgtgagcaccgacgccgaggta
gccgcttcaccgagcatcgaggacacaatcaacgcatccaccacgctgcggtctcgtacg
ttgagctctgcgcacgccagcttggtcgacacctcgtttctggcgcatgcgccaatgcat
gtcgacgctgcagacacgcacgcaagctcggattcgttgggacaactctacgacaacggc
gactcttggatacatcaacactcgttgttgggtggagaaccagatgcgcctggatcgccc
gattggagtgcagcgcacgcgtgtgttccaagcacataccagggcgaacccgaaacacag
gcgccagccacgttgggtactgcagtgacgtcttccgaattcacaggcgcggctggtgtg
gaaaaccaggcgtctcgccaacaccaggcgcccgtgtcgtcgagctcgtcgctctacccc
gacttagccagctgccacttggcgcatcctacgcagtaa

DBGET integrated database retrieval system