KEGG   Ustilago maydis: UMAG_11945Help
Entry
UMAG_11945        CDS       T01021                                 

Definition
(RefSeq) putative hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
uma  Ustilago maydis
Pathway
uma00010  Glycolysis / Gluconeogenesis
uma00051  Fructose and mannose metabolism
uma00052  Galactose metabolism
uma00500  Starch and sucrose metabolism
uma00520  Amino sugar and nucleotide sugar metabolism
uma01100  Metabolic pathways
uma01110  Biosynthesis of secondary metabolites
uma01130  Biosynthesis of antibiotics
uma01200  Carbon metabolism
Module
uma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
uma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMAG_11945
   00051 Fructose and mannose metabolism
    UMAG_11945
   00052 Galactose metabolism
    UMAG_11945
   00500 Starch and sucrose metabolism
    UMAG_11945
   00520 Amino sugar and nucleotide sugar metabolism
    UMAG_11945
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UMAG_11945
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UMAG_11945
Membrane trafficking [BR:uma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UMAG_11945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 YjgF_endoribonc
Motif
Other DBs
NCBI-GeneID: 23567750
NCBI-ProteinID: XP_011389570
UniProt: A0A0D1CRB6
LinkDB All DBs
Position
7
AA seq 515 aa AA seqDB search
MSFSSEKGSSRRGSISLASKRRGSGTEKLETHIASWHTSSHKHEENPHAHEEQLKQTYER
FEKLFTITPQRLRMITDRFVGVLEEGLQKDGQTVPMLPAYVFGWPTGDEVGSYLALDLGG
TNLRVCHVVLKGAGKFEITQSKFRLTEEQKQTEGQELFDFCADCLATFIKDHFGDQNGDV
ILEEELALGFTFSYPMEQDKIDHGKLVRWTKGFGNPNTEGRDCAAMFRKSLDKFNLPVKM
VSIINDTTGTLIASNYVNRETRIACIFGTGCNAAYMEHMKDIPKIKHLGLPEEEDMAINC
EYGAFDSFQHEHMAEIRTKYDEHIDLHSNKPHEQSYEKMIAGLYLGEIFRLCICDLIDEG
TLFLGQNTYKLEKTNAFDTAFLSLIESDPTDELLTVTGLFTHFFGIDTTIEERQFFRKLA
KLIGTRSARLSSCGIAALVTKMGYLDKGCGVGADGSLYSKYPGFADRLHQALEDIFGEKG
RNIRTYQAEDGSGVGSAIIAAMTKARKEEGKYADV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcttccgaaaaaggcagcagccgccgcggctccatctcgcttgccagtaag
cgtcgaggctctggtaccgagaagctcgaaactcatatcgcctcatggcacaccagttcc
cacaagcacgaggaaaacccacatgcgcacgaggaacagctcaagcagacctacgagcgt
ttcgagaagctcttcaccatcacgcctcagcgtctgcgcatgatcaccgatcgtttcgtc
ggagtccttgaggagggtcttcagaaggatggtcagaccgtgcccatgctccctgcctat
gtctttggctggcccaccggtgacgaggtcggctcttacctcgctcttgacctcggtggc
accaacttgcgtgtctgccacgttgttctcaagggcgccggaaagttcgagattacacag
tccaaattccgtctcacagaggagcagaagcagaccgaaggtcaggaactctttgacttt
tgtgccgactgcttggccactttcatcaaggaccactttggcgaccaaaacggcgacgtc
atccttgaagaggagcttgcgctcggattcaccttcagctacccgatggagcaggacaaa
atcgatcatggcaagctcgtccgatggaccaaaggcttcggcaaccccaacaccgaaggc
cgcgactgcgctgccatgttccgcaaatcgcttgacaagttcaatttgcctgtcaagatg
gtctcgatcatcaacgataccaccggaacgctcatcgcctctaactatgtcaaccgcgaa
accaggatcgcctgcatctttggtaccggctgtaacgccgcctacatggagcacatgaag
gacattcccaagatcaagcacctcggcctccccgaggaagaggacatggccatcaactgc
gagtacggcgcctttgactcgtttcagcacgagcacatggccgagatccgaaccaagtac
gacgaacacattgaccttcactcgaacaagccacacgagcagtcgtatgaaaagatgatc
gccggtctctacctgggcgagattttccgactgtgcatctgcgacctgatcgacgagggt
acgctcttcttgggccagaacacgtacaagctggaaaagaccaacgccttcgacacggcc
ttcctgtcgttgattgaatccgaccctacggacgagcttttgactgtgaccggtctgttt
acacacttctttggtatcgacactacgatcgaggagaggcaattcttccgcaagctggcc
aaactcatcggtacacgatcggcgcgtctgagctcgtgcggtatcgctgcgctggtaacc
aagatgggttacctggacaagggatgcggtgtgggtgccgacggttcgctctactctaaa
tatcctggattcgccgaccgcttgcaccaggcgctcgaggatatctttggcgaaaagggg
cgcaacattcgcacctaccaggctgaagacggttcgggtgtaggatcggccatcattgct
gccatgaccaaggcacgcaaggaggagggcaagtacgccgatgtgtaa

DBGET integrated database retrieval system