KEGG   Ursus maritimus (polar bear): 103656573Help
Entry
103656573         CDS       T03271                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00040  Pentose and glucuronate interconversions
umr00051  Fructose and mannose metabolism
umr01100  Metabolic pathways
Module
umr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103656573 (SORD)
   00051 Fructose and mannose metabolism
    103656573 (SORD)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103656573 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 103656573
NCBI-ProteinID: XP_008682212
UniProt: A0A384BI03
LinkDB All DBs
Position
Un
AA seq 356 aa AA seqDB search
MAAAWAENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFV
VEKPMVLGHEASGTVIKVGSLVKHLKAGDRVAIEPGALREMDEFCKIGRYNLSPSIFFCA
TPPDDGNLCRFYKHNADFCYKLPDNVTFEEGALIEPLSVGIHACRRAGITLGNKVFVCGA
GPIGLVTLIVAKAMGAAQVLVTDLSASRLSKAKEVGADIILQISKESPKEVASKVEGLLG
CKPEVTIECTGAEPAIQSGIYATRSGGTLVLVGLGSEMTTVPLVHAAIREVDIKGVFRYC
NTWPMAISMLASKSVNVMPLVTHRFPLEKALEAFETARKGLGLKVMLKCDPKDQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcctgggccgagaacctctctctggtggtgcacggacccggagacctgcgc
ctggagaactatcctatccctgaaccaggcccaaatgaagtgctgctgaagatgcattcc
gttggaatctgcggctcagatgtccactactggcagcatggtcgaattggggattttgtt
gtggaaaagccaatggtgctggggcatgaagcctcagggacagtcataaaagtgggatca
ctggtaaagcacttaaaagcaggggatcgtgttgccatcgagcctggcgctctgcgagaa
atggatgaattctgcaagattggccgatacaatctgtcgccatccatcttcttctgtgcc
acgccccctgatgacgggaacctctgccgcttttataagcacaacgctgacttctgctac
aagcttcctgacaatgtcacctttgaagaaggggccctgatcgaaccactgtctgtaggg
atccatgcctgccggcgagctgggatcaccctggggaacaaggtcttcgtgtgtggagct
gggccgattggactcgtcactctgatcgtggccaaggccatgggtgcagctcaagtgctg
gttactgatctgtctgcctctcggttgtctaaagccaaggaagttggggctgatatcatc
ctccagatctccaaggagagccctaaggaagtggccagtaaagtggaaggtctgctgggg
tgcaagccagaggtgaccatcgagtgcacaggggcggagcctgccatccagtcaggcatc
tatgctactcgttctggtgggactctggtgctcgtagggctgggctctgagatgaccact
gtgcccctggtgcacgcagccatccgggaagtggatatcaagggcgtgtttcgatattgc
aacacgtggccgatggcgatttcgatgcttgcctccaagtctgtgaatgtaatgccctta
gttacccataggtttcctctggagaaagctctggaggcctttgaaacagccagaaaggga
ttggggttgaaagtcatgctcaagtgcgaccccaaggaccagaatccctaa

DBGET integrated database retrieval system