KEGG   Ursus maritimus (polar bear): 103656694
Entry
103656694         CDS       T03271                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04530  Tight junction
umr04660  T cell receptor signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05212  Pancreatic cancer
umr05214  Glioma
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103656694 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103656694 (CDK4)
   04115 p53 signaling pathway
    103656694 (CDK4)
   04218 Cellular senescence
    103656694 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103656694 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103656694 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103656694 (CDK4)
   05203 Viral carcinogenesis
    103656694 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103656694 (CDK4)
   05225 Hepatocellular carcinoma
    103656694 (CDK4)
   05214 Glioma
    103656694 (CDK4)
   05220 Chronic myeloid leukemia
    103656694 (CDK4)
   05218 Melanoma
    103656694 (CDK4)
   05219 Bladder cancer
    103656694 (CDK4)
   05224 Breast cancer
    103656694 (CDK4)
   05222 Small cell lung cancer
    103656694 (CDK4)
   05223 Non-small cell lung cancer
    103656694 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103656694 (CDK4)
   04934 Cushing syndrome
    103656694 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103656694 (CDK4)
   05160 Hepatitis C
    103656694 (CDK4)
   05164 Influenza A
    103656694 (CDK4)
   05162 Measles
    103656694 (CDK4)
   05163 Human cytomegalovirus infection
    103656694 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103656694 (CDK4)
   05169 Epstein-Barr virus infection
    103656694 (CDK4)
   05165 Human papillomavirus infection
    103656694 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103656694 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103656694 (CDK4)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103656694 (CDK4)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103656694 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 103656694
NCBI-ProteinID: XP_008682339
UniProt: A0A384BJ97
LinkDB
Position
Un
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta
tacaaggcccgcgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct
aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg
cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc
gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctcgatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctagctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgcctcgaggagccttttcccccagagggccccgcccagtgcagtcagtg
gtacctgagttggaggagtctggagcacaactgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

KEGG   Ursus maritimus (polar bear): 103658796
Entry
103658796         CDS       T03271                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05212  Pancreatic cancer
umr05214  Glioma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103658796 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103658796 (CDK6)
   04115 p53 signaling pathway
    103658796 (CDK6)
   04218 Cellular senescence
    103658796 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658796 (CDK6)
   05206 MicroRNAs in cancer
    103658796 (CDK6)
   05203 Viral carcinogenesis
    103658796 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103658796 (CDK6)
   05225 Hepatocellular carcinoma
    103658796 (CDK6)
   05214 Glioma
    103658796 (CDK6)
   05220 Chronic myeloid leukemia
    103658796 (CDK6)
   05218 Melanoma
    103658796 (CDK6)
   05224 Breast cancer
    103658796 (CDK6)
   05222 Small cell lung cancer
    103658796 (CDK6)
   05223 Non-small cell lung cancer
    103658796 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103658796 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103658796 (CDK6)
   05164 Influenza A
    103658796 (CDK6)
   05162 Measles
    103658796 (CDK6)
   05163 Human cytomegalovirus infection
    103658796 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103658796 (CDK6)
   05169 Epstein-Barr virus infection
    103658796 (CDK6)
   05165 Human papillomavirus infection
    103658796 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103658796 (CDK6)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103658796 (CDK6)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103658796 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 103658796
NCBI-ProteinID: XP_008684531
UniProt: A0A384BPK8
LinkDB
Position
Un
AA seq 250 aa
MWLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFL
HSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSY
ATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHS
KSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYFHDLERCKENLDAHLPP
SQNSSEMNTA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtggttgtttgatgtatgcacagtgtcacgaacagacagagaaaccaaactaacgtta
gtgtttgaacatgttgatcaagacttgaccacttatttggataaagtcccggagcctgga
gtgcccactgaaaccataaaggatatgatgtttcagcttctccgaggtctagactttctt
cattctcaccgagtggtgcatcgtgatctcaaaccacagaacattctggtgaccagcagt
ggacaaataaagctggctgacttcggccttgcccgcatctacagttttcagatggctctt
acctcagtggtcgtcacgctgtggtacagagctccagaagtcttgcttcagtccagctac
gccacccccgtggacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaag
cctctttttcgtggaagttcagatgtcgatcagcttggaaaaatcttggatgtaattgga
ctcccaggagaagaggactggccaagggatgtcgcccttcccagacaggcttttcactcc
aaatctcctcaaccgattgagaagttcgtaacagatattgatgagcaaggcaaggacctc
cttctgaagtgcttaacatttaatccagccaaaagaatatctgcctacagtgctctgtct
cacccgtacttccatgacctggagaggtgcaaggagaatctggatgcccatctgccgccc
agccagaacagctcggagatgaatacagcctga

DBGET integrated database retrieval system