Ursus maritimus (polar bear): 103656694 Help Entry 103656694         CDS       T03271                                  Gene name CDK4 Definition (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04110   Cell cycle umr04115   p53 signaling pathway umr04151   PI3K-Akt signaling pathway umr04218   Cellular senescence umr04530   Tight junction umr04660   T cell receptor signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr04934   Cushing syndrome umr05160   Hepatitis C umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05200   Pathways in cancer umr05203   Viral carcinogenesis umr05212   Pancreatic cancer umr05214   Glioma umr05218   Melanoma umr05219   Bladder cancer umr05220   Chronic myeloid leukemia umr05222   Small cell lung cancer umr05223   Non-small cell lung cancer umr05224   Breast cancer umr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     103656694 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103656694 (CDK4)    04115 p53 signaling pathway     103656694 (CDK4)    04218 Cellular senescence     103656694 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     103656694 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     103656694 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103656694 (CDK4)    05203 Viral carcinogenesis     103656694 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     103656694 (CDK4)    05225 Hepatocellular carcinoma     103656694 (CDK4)    05214 Glioma     103656694 (CDK4)    05220 Chronic myeloid leukemia     103656694 (CDK4)    05218 Melanoma     103656694 (CDK4)    05219 Bladder cancer     103656694 (CDK4)    05224 Breast cancer     103656694 (CDK4)    05222 Small cell lung cancer     103656694 (CDK4)    05223 Non-small cell lung cancer     103656694 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103656694 (CDK4)    04934 Cushing syndrome     103656694 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103656694 (CDK4)    05160 Hepatitis C     103656694 (CDK4)    05164 Influenza A     103656694 (CDK4)    05162 Measles     103656694 (CDK4)    05163 Human cytomegalovirus infection     103656694 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     103656694 (CDK4)    05169 Epstein-Barr virus infection     103656694 (CDK4)    05165 Human papillomavirus infection     103656694 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103656694 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103656694 (CDK4) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      103656694 (CDK4) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   CDK family    103656694 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  103656694 NCBI-ProteinID:  XP_008682339 UniProt:  A0A384BJ97 LinkDB All DBs Position Un AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta tacaaggcccgcgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg atgcgccagtttctaagaggcctcgatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctagctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga gatgtgtctctgcctcgaggagccttttcccccagagggccccgcccagtgcagtcagtg gtacctgagttggaggagtctggagcacaactgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

Ursus maritimus (polar bear): 103658796 Help Entry 103658796         CDS       T03271                                  Gene name CDK6 Definition (RefSeq) cyclin dependent kinase 6   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism umr  Ursus maritimus (polar bear) Pathway umr04110   Cell cycle umr04115   p53 signaling pathway umr04151   PI3K-Akt signaling pathway umr04218   Cellular senescence umr04934   Cushing syndrome umr05160   Hepatitis C umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05200   Pathways in cancer umr05203   Viral carcinogenesis umr05206   MicroRNAs in cancer umr05212   Pancreatic cancer umr05214   Glioma umr05218   Melanoma umr05220   Chronic myeloid leukemia umr05222   Small cell lung cancer umr05223   Non-small cell lung cancer umr05224   Breast cancer umr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     103658796 (CDK6)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103658796 (CDK6)    04115 p53 signaling pathway     103658796 (CDK6)    04218 Cellular senescence     103658796 (CDK6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103658796 (CDK6)    05206 MicroRNAs in cancer     103658796 (CDK6)    05203 Viral carcinogenesis     103658796 (CDK6)   09162 Cancer: specific types    05212 Pancreatic cancer     103658796 (CDK6)    05225 Hepatocellular carcinoma     103658796 (CDK6)    05214 Glioma     103658796 (CDK6)    05220 Chronic myeloid leukemia     103658796 (CDK6)    05218 Melanoma     103658796 (CDK6)    05224 Breast cancer     103658796 (CDK6)    05222 Small cell lung cancer     103658796 (CDK6)    05223 Non-small cell lung cancer     103658796 (CDK6)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103658796 (CDK6)   09172 Infectious disease: viral    05160 Hepatitis C     103658796 (CDK6)    05164 Influenza A     103658796 (CDK6)    05162 Measles     103658796 (CDK6)    05163 Human cytomegalovirus infection     103658796 (CDK6)    05167 Kaposi sarcoma-associated herpesvirus infection     103658796 (CDK6)    05169 Epstein-Barr virus infection     103658796 (CDK6)    05165 Human papillomavirus infection     103658796 (CDK6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103658796 (CDK6) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      103658796 (CDK6) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   CDK family    103658796 (CDK6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7 Motif Other DBs NCBI-GeneID:  103658796 NCBI-ProteinID:  XP_008684531 UniProt:  A0A384BPK8 LinkDB All DBs Position Un AA seq 250 aa AA seqDB search MWLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFL HSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSY ATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHS KSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYFHDLERCKENLDAHLPP SQNSSEMNTA NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atgtggttgtttgatgtatgcacagtgtcacgaacagacagagaaaccaaactaacgtta gtgtttgaacatgttgatcaagacttgaccacttatttggataaagtcccggagcctgga gtgcccactgaaaccataaaggatatgatgtttcagcttctccgaggtctagactttctt cattctcaccgagtggtgcatcgtgatctcaaaccacagaacattctggtgaccagcagt ggacaaataaagctggctgacttcggccttgcccgcatctacagttttcagatggctctt acctcagtggtcgtcacgctgtggtacagagctccagaagtcttgcttcagtccagctac gccacccccgtggacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaag cctctttttcgtggaagttcagatgtcgatcagcttggaaaaatcttggatgtaattgga ctcccaggagaagaggactggccaagggatgtcgcccttcccagacaggcttttcactcc aaatctcctcaaccgattgagaagttcgtaacagatattgatgagcaaggcaaggacctc cttctgaagtgcttaacatttaatccagccaaaagaatatctgcctacagtgctctgtct cacccgtacttccatgacctggagaggtgcaaggagaatctggatgcccatctgccgccc agccagaacagctcggagatgaatacagcctga

DBGET integrated database retrieval system