KEGG   Ursus maritimus (polar bear): 103656766Help
Entry
103656766         CDS       T03271                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00480  Glutathione metabolism
umr00980  Metabolism of xenobiotics by cytochrome P450
umr00982  Drug metabolism - cytochrome P450
umr00983  Drug metabolism - other enzymes
umr01524  Platinum drug resistance
umr05200  Pathways in cancer
umr05204  Chemical carcinogenesis
umr05225  Hepatocellular carcinoma
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103656766 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103656766 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    103656766 (GSTO1)
   00983 Drug metabolism - other enzymes
    103656766 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103656766 (GSTO1)
   05204 Chemical carcinogenesis
    103656766 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    103656766 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103656766 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    103656766 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:umr02000]
    103656766 (GSTO1)
Enzymes [BR:umr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103656766 (GSTO1)
Transporters [BR:umr02000]
 Other Transporters
  Pores ion channels [TC:1]
   103656766 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 103656766
NCBI-ProteinID: XP_008682448
UniProt: A0A384BIM9
LinkDB All DBs
Position
Un
AA seq 213 aa AA seqDB search
MRFCPFAQRTRLVLKAKGIRHEIININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAI
TCEYLDEAYPGKKLLPDDPYEKAYQKMVFELFSKIPSLVASFLRRQNEEDCSGLKEELRK
EFSKLEEVLTNKKTTFFGGNSVSMIDYLIWPWFERLEVLELNDCADHTLELKLWMAAMRE
DPAVSALLTEPKVFRGFLSLYLQNSPDACDYGL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctgcccgttcgcgcagaggacacgcctggtcctgaaggccaagggaatcagg
catgaaatcatcaacatcaacctgaaaaataagcctgagtggttctttaagaagaatccc
tttggcctggtgccagttctggaaaacagtcagggtcaactgatctacgaatctgccatc
acttgtgagtacctggatgaagcctatcccgggaagaagctgttgccagacgacccctat
gagaaagcttaccaaaagatggtgttcgagttattttcgaagattccatctttggtagca
agctttctgagaagacaaaatgaggaagactgctctggcctaaaagaagaattgcggaaa
gaattcagcaagcttgaggaggttcttaccaataagaagacaaccttctttggtggcaat
tctgtttctatgattgattacctcatctggccctggtttgaacggctggaagttctggag
ttaaatgattgtgcagaccacactcttgaacttaagctctggatggcagccatgagggaa
gatcctgcagtgtcagccctcctcactgagcccaaggtctttcgaggtttcctcagtctc
tatttgcagaacagccccgacgcctgtgactatgggctctga

DBGET integrated database retrieval system