KEGG   Ursus maritimus (polar bear): 103656774
Entry
103656774         CDS       T03271                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04064  NF-kappa B signaling pathway
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04668  TNF signaling pathway
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103656774 (TRAF3)
   04668 TNF signaling pathway
    103656774 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103656774 (TRAF3)
   04621 NOD-like receptor signaling pathway
    103656774 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    103656774 (TRAF3)
   04657 IL-17 signaling pathway
    103656774 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103656774 (TRAF3)
   05203 Viral carcinogenesis
    103656774 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103656774 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103656774 (TRAF3)
   05160 Hepatitis C
    103656774 (TRAF3)
   05171 Coronavirus disease - COVID-19
    103656774 (TRAF3)
   05164 Influenza A
    103656774 (TRAF3)
   05162 Measles
    103656774 (TRAF3)
   05168 Herpes simplex virus 1 infection
    103656774 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103656774 (TRAF3)
   05169 Epstein-Barr virus infection
    103656774 (TRAF3)
   05165 Human papillomavirus infection
    103656774 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Tropomyosin_1 Spc7 Cast Spc29 KxDL T3SSipB FliJ Exonuc_VII_L zf-RING_6 DUF1664 BLOC1_2 Fib_alpha GAS SPATA24 DUF3450 V_ATPase_I ADIP
Other DBs
NCBI-GeneID: 103656774
NCBI-ProteinID: XP_008682425
UniProt: A0A384BJX0
LinkDB
Position
Un
AA seq 568 aa
MEPSKKMDPPGTLQANPPLKLHPDRGAGTSVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRNE
GGGCTEQLTLGHLLVHLKNDCQFEELSCVRADCKEKVLRRDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagccaagtaaaaagatggacccccccggcaccctacaggcaaacccaccgctaaag
ctgcaccctgaccggggcgccgggacgtccgtcttcgtccccgaacaaggaggttacaaa
gaaaggtttgtgaagaccgtggaagacaagtacaagtgtgagaagtgccgcctggtgctg
tgtaacccgaagcagacagagtgcggacaccggttctgcgagacctgcatggctgccttg
ctgagctcctcaagcccaaaatgtactgcgtgtcaagaaggcatcattaaagataaggtg
tttaaggataattgctgcaagagagagatccttgctcttcagatctactgcaggaatgaa
ggtgggggctgcacagagcagttgacactggggcacctgctggtgcatttaaagaacgat
tgccagtttgaagagctttcatgcgtccgcgctgactgcaaagaaaaagtgttgcgaaga
gacctgcgtgaccacgtggaaaaggcctgcaagtaccgggaggccacgtgcagccactgc
aaaagtcaggtcccgatgatcacgctgcagaaacatgaagacactgagtgtccctgtgtg
gtggtgtcctgcccccataagtgcagtgtccagacccttctgaggagtgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagattaaggcccatgaggccagctccgcggtgcagcatgtc
aacttactgaaagagtggagtaactctctagagaaaaaggtttccctgctacagaatgaa
agtgtagagaaaaacaagagtatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgctccgaaataatgaatccaaaatacttcatttacag
cgagtgatagacagtcaggcggagaaactgaaagagctggacaaagagatccgccccttc
cggcagaactgggaagaagcagacagcatgaagagcagcgtggaatccctccagaaccga
gtgacggagctggagagtgtggacaaaagtgcaggacaggtggctcggaacacaggcttg
ctggagtcccagctgagccggcatgaccagatgcttagcgtccacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggcgtgctgatttgg
aagatccgagattataagcggcggaagcaggaagctgtcatggggaagacgctgtctctt
tacagccagcctttctacacaggctattttggctataagatgtgtgccagggtctacctg
aacggggacggcatggggaaggggacgcacttgtcgctgttctttgtcatcatgcgcgga
gagtacgacgccctgcttccttggccgttcaagcagaaagtgacgctcatgctgatggat
caggggtcctctcggcgccacctgggagatgcgttcaagccggaccccaacagcagcagc
ttcaagaagcccaccggggagatgaatattgcctctggctgcccagtgtttgtggcccaa
accgtgctagaaaacgggacatatattaaagatgataccatttttattaaagtcatagtg
gatacttcggatctgcccgacccctga

DBGET integrated database retrieval system