KEGG   Ursus maritimus (polar bear): 103656869
Entry
103656869         CDS       T03271                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04120  Ubiquitin mediated proteolysis
umr04144  Endocytosis
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04625  C-type lectin receptor signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103656869 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103656869 (MDM2)
   04151 PI3K-Akt signaling pathway
    103656869 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103656869 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    103656869 (MDM2)
   04115 p53 signaling pathway
    103656869 (MDM2)
   04218 Cellular senescence
    103656869 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103656869 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103656869 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103656869 (MDM2)
   05202 Transcriptional misregulation in cancer
    103656869 (MDM2)
   05206 MicroRNAs in cancer
    103656869 (MDM2)
   05205 Proteoglycans in cancer
    103656869 (MDM2)
   05203 Viral carcinogenesis
    103656869 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    103656869 (MDM2)
   05220 Chronic myeloid leukemia
    103656869 (MDM2)
   05218 Melanoma
    103656869 (MDM2)
   05219 Bladder cancer
    103656869 (MDM2)
   05215 Prostate cancer
    103656869 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103656869 (MDM2)
   05169 Epstein-Barr virus infection
    103656869 (MDM2)
   05165 Human papillomavirus infection
    103656869 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103656869 (MDM2)
   01522 Endocrine resistance
    103656869 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103656869 (MDM2)
   04121 Ubiquitin system [BR:umr04121]
    103656869 (MDM2)
Enzymes [BR:umr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103656869 (MDM2)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    103656869 (MDM2)
Ubiquitin system [BR:umr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    103656869 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 103656869
NCBI-ProteinID: XP_008682493
UniProt: A0A384BIS0
LinkDB
Position
Un
AA seq 487 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKEPAQELQEEKPSSSDLVSRPSTSSRRRAISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKIPEKAKLENSTQVEEGFDVPDCKK
TAVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQDKEE
VVESSFPLNAIEPCVICQGRPKNGCIVHGRTGHLMACFTCAKKLKKRNKPCPVCRQPIQM
IVLTYFP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaggagaccctggttagaccaaagcctttgcttttgaagttgttaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggagccggcgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccgtctacctcatct
agaaggagagcaattagtgagacagaagaacattcagatgaattacctggtgaacggcag
agaaagcgccacaaatctgatagtatttccctgtcctttgatgaaagccttgctctgtgt
gtaataagggagatatgctgtgaaagaagcagtagcagtgaatcaacagggacaccatca
aatccggatcttgatgctggtgtaagtgagcattcaggtgactggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattacagt
cttagtgaagaagggcaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgataccgattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaac
agatgttgggcccttcgtgagaactggcttcctgaagataaagggaaaatacctgagaaa
gccaaactagaaaactcaacacaagtagaagagggctttgatgtccctgattgtaaaaaa
actgcagtgaatgattccagagaatcatgtgctgaggaaaatgatgataaaatcacacaa
gcctcccaatcccaagaaagtgaggattattctcagccatcaacttctaacagcatcatt
tacagcagccaagaagatgtcaaagagtttgagagggaggaaacacaagacaaagaagag
gttgtggaatctagttttcccctgaatgccattgaaccttgtgtgatttgccagggtcga
cctaaaaacggttgcattgttcatggcagaacaggacatcttatggcgtgctttacgtgt
gcaaagaagctcaagaaaaggaataagccctgcccagtatgtagacagccaattcaaatg
attgtgctaacttatttcccctag

DBGET integrated database retrieval system