KEGG   Ursus maritimus (polar bear): 103657101
Entry
103657101         CDS       T03271                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04714  Thermogenesis
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103657101 (FGF21)
   04014 Ras signaling pathway
    103657101 (FGF21)
   04015 Rap1 signaling pathway
    103657101 (FGF21)
   04020 Calcium signaling pathway
    103657101 (FGF21)
   04151 PI3K-Akt signaling pathway
    103657101 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103657101 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103657101 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103657101 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    103657101 (FGF21)
   05218 Melanoma
    103657101 (FGF21)
   05224 Breast cancer
    103657101 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103657101 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103657101 (FGF21)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103657101 (FGF21)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103657101 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103657101
NCBI-ProteinID: XP_008682738
UniProt: A0A384BJG4
LinkDB
Position
Un
AA seq 209 aa
MGWDEARSEQLGLWVPVLAVLLLEACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH
LEIRADGTVVGAARRSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLHFDPVA
CSFRELLLEDGYNIYHSETLGLPLRLPAHNSPYRDLAPRGPARFLPLPGLLPVPPDPPGI
LGPEPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggctgggatgaggccaggtccgagcagctggggctgtgggtccctgtgctggctgtc
cttttgctggaagcttgccaggcacaccctatccctgactccagccccctcctccaattc
ggaggccaagttcgacagcggtacctgtacacggacgatgcccaggagacagaggcccac
ctagagatcagggctgatggcacagtggtgggggctgcccgccgcagcccagaaagtctc
ttggagctgaaagccctgaaaccgggggtcattcaaatcctgggagtgaaaacatctagg
ttcctgtgccagggcccagatgggacactgtacggatcgctccacttcgaccccgtagcc
tgcagcttccgggaactgcttctggaggatgggtacaacatctaccactccgagaccctc
ggcctcccacttcgcctgcccgcccacaactctccataccgggacttggcgccccggggg
cctgcccgcttcctgcccctgccaggcctgcttccggtccccccggaccccccagggatc
ctgggccccgagcctcccgacgtgggctcctcggaccccctgagcatggtggggccttcg
cagggccgaagtcccagctacgcttcctga

KEGG   Ursus maritimus (polar bear): 103658054
Entry
103658054         CDS       T03271                                 

Gene name
PDGFC
Definition
(RefSeq) platelet derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04810  Regulation of actin cytoskeleton
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103658054 (PDGFC)
   04014 Ras signaling pathway
    103658054 (PDGFC)
   04015 Rap1 signaling pathway
    103658054 (PDGFC)
   04020 Calcium signaling pathway
    103658054 (PDGFC)
   04072 Phospholipase D signaling pathway
    103658054 (PDGFC)
   04151 PI3K-Akt signaling pathway
    103658054 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103658054 (PDGFC)
   04540 Gap junction
    103658054 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103658054 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103658054 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    103658054 (PDGFC)
   05215 Prostate cancer
    103658054 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103658054 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103658054 (PDGFC)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103658054 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 103658054
NCBI-ProteinID: XP_008683757
UniProt: A0A384BMF8
LinkDB
Position
Un
AA seq 345 aa
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQYSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVVPQFTEAVSPSVLPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKSGVRGLHKSLTDVALEHHEECDCVCRGHTGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatctgccctggccggccagagacacgggact
caggctgagtccaacctgagtagtaaattccagtactccagcaacaaggaacagaacgga
gtacaagatccccagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaagatttcctcatacttacccaagaaatatggtcttggtatggagactggtagcagca
gaggaaaatgtatggatacaacttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgatttcgtagaagttgaagaacccagtgatggaacgatatta
gggcgttggtgtggttctggtactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcgtgccacaattcacagaggccgtgagcccttccgtgttacccccttcagct
ttgccactggatctgcttaataacgctgtcactgcgtttagtaccttggaagatctcatt
cggtatcttgaaccagacagatggcagttggacttggaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggacctgaacctt
ctaaaggaggaggtaagactgtacagctgcacgccccgtaacttctcggtgtccataagg
gaagagctaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtggaaactgtgcttgctgtctccacaactgcaatgagtgtcagtgtgtcccgagcaaa
gtcactaaaaaatatcatgaggtccttcagttgagaccaaagagtggggtccggggattg
cataaatctctcacggacgtggccctggagcaccacgaggagtgtgactgtgtgtgcaga
gggcacacgggaggataa

KEGG   Ursus maritimus (polar bear): 103658669
Entry
103658669         CDS       T03271                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr05144  Malaria
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05211  Renal cell carcinoma
umr05218  Melanoma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103658669 (HGF)
   04014 Ras signaling pathway
    103658669 (HGF)
   04015 Rap1 signaling pathway
    103658669 (HGF)
   04020 Calcium signaling pathway
    103658669 (HGF)
   04151 PI3K-Akt signaling pathway
    103658669 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103658669 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658669 (HGF)
   05205 Proteoglycans in cancer
    103658669 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103658669 (HGF)
   05226 Gastric cancer
    103658669 (HGF)
   05218 Melanoma
    103658669 (HGF)
   05211 Renal cell carcinoma
    103658669 (HGF)
   05223 Non-small cell lung cancer
    103658669 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    103658669 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103658669 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103658669 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103658669 (HGF)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103658669 (HGF)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103658669 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 103658669
NCBI-ProteinID: XP_008684405
UniProt: A0A384BP91
LinkDB
Position
Un
AA seq 730 aa
MWGTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMTSGVKKDFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTNVPV
ETTECIHGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGKGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGSINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKIPQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggggaccaaacttctgccagtcctgctgctgcagcatgtcctcctacatctgctt
ctgcttcccatcgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaa
acaaaaaaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaaggaaaagatgcctctggttccct
ttcaatagcatgacaagtggcgtgaaaaaagactttggtcatgaattcgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggta
tctatcactaagagtggcatcaaatgccagccctggaattccatgatcccacatgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttccgaagttgaatgcatgacctgcaatggggaaagttatcga
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgccagaaagatatcccgacaagggctttgatgataattattgc
cgcaatcctgatggcaaaccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaaatgtgcgctcacagtactatgaatgacacaaatgtccctgtg
gaaacaactgaatgcattcatggtcaaggagaaggttaccggggcaccatcaatactatt
tggaatggaattccatgtcagcgttgggattcccagtatcctcaccagcatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccgaaatccagatggggct
gagtcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgatgtgtcaagtggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaatttatccaaaactcgatctggactaacatgttcaatgtgggagaagaacatggaa
gacttacacaggcatatcttctgggaaccagatgctagtaagctgaataagaattactgc
cggaatcctgatgatgatgcccatggtccctggtgttacacaggaaatcctctcattcca
tgggattattgtcctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgtgccaaaacgaaacaattaagagttgtaaatggaattcca
acgcgaactaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtgga
ggatcattgataaaggaaagttggattcttaccgcaagacaatgtttcccttctcgaaac
aaagacttgaaagattatgaagcttggcttgggattcatgatgtccacggaaaaggagac
gagaaacgcaaacaagttctaaatgtttcccagctggtatatggacctgaaggatcagat
ctggtattactgaagcttgctaggcccgctgtcctggatgattttgttagtacaattgat
ttacctaattatggatgcaccattcctgaaaaaaccacttgcagtgtttatggctggggt
tatactggatccatcaactctgatggtctattacgagtagcacatctctatattatggga
aatgagaaatgcagccaataccatcaagggaaggtgactctgaatgagtctgaaatatgt
gctggagctgaaaatattgtatcaggaccatgtgagggagattatggtggcccacttgtt
tgtgaacaacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgcc
ataccaaatcgtcctggcatttttgtccgagtagcatattacgcaaaatggatacacaaa
attatattaacgtataagataccacagtcatag

KEGG   Ursus maritimus (polar bear): 103658995
Entry
103658995         CDS       T03271                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103658995 (FGF8)
   04014 Ras signaling pathway
    103658995 (FGF8)
   04015 Rap1 signaling pathway
    103658995 (FGF8)
   04020 Calcium signaling pathway
    103658995 (FGF8)
   04151 PI3K-Akt signaling pathway
    103658995 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103658995 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658995 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    103658995 (FGF8)
   05218 Melanoma
    103658995 (FGF8)
   05224 Breast cancer
    103658995 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103658995 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103658995 (FGF8)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103658995 (FGF8)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103658995 (FGF8)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103658995
NCBI-ProteinID: XP_008684733
UniProt: A0A384BQ59
LinkDB
Position
Un
AA seq 363 aa
MGATRAPGQSSIIMACCVFFNFLKVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSR
TSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAK
CPGLVLQSSYWANPGTSSLWASVPRHCFGVGVTPRLPNHVGLSELKGNAPVPSHPMLGHC
MPSHLIVLPSLSLGFLDTLPSLPPVTLSNEEETHKTLTAANTPCRIRLISGVIGEAGGRQ
GEVPVFRLHPLHWGSHTNGVGSIWVSTMYSTGGDRERGRREDESRGAVWTPQGNLSFLNL
NFLIEKVEKEMEGPSPSGFSGAFRQKTLARALRGGGVGWAPGLPSRAAPVAPAPREGASR
SSS
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgggggccactcgggcccctgggcagagtagcattataatggcgtgttgtgtatttttc
aatttcctaaaggtaactgttcagtcctcacctaattttacacagcatgtgagggagcag
agcctggtgacggatcagctcagccgccgcctcatccggacctaccagctctacagccgc
accagcgggaagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaagac
ggggaccccttcgcaaagctcattgtggagacagatacctttgggagccgggttcgagtc
cgcggagctgagactggcctctacatctgcatgaataagaaggggaagctgatcgccaag
tgccctgggctggtcctacagtccagctactgggccaatccaggaacctcttccctctgg
gcctctgttcctcggcactgctttggagtgggggtcaccccaaggctgcctaaccacgtg
ggcctctcagagctgaagggaaatgcccctgtcccatcgcaccctatgctgggccattgt
atgccctcccacctcatcgtcctgcccagtctctccctgggctttctggacaccctcccc
tccctgccccctgtaaccctcagtaatgaggaggagactcataaaacattgaccgcggct
aatacgccgtgtaggatccgccttatctcaggtgtgataggagaggctgggggcagacaa
ggcgaggtcccggtcttcaggctgcaccccttgcactggggttcacatactaacggcgtg
ggcagcatctgggttagcaccatgtactccactgggggggatcgtgaaaggggtcgcaga
gaagatgagtcaagaggagcagtgtggactcctcagggaaacttatctttcctgaacctt
aatttcctcatcgagaaggtggagaaggagatggagggtccgagcccttcggggttctcg
ggggcattccggcagaagacgctggcaagggccctccggggaggaggggtcgggtgggct
ccaggcctgccgtccagggccgcccccgtggccccagccccccgggaaggtgcctccagg
agcagcagctga

KEGG   Ursus maritimus (polar bear): 103661742
Entry
103661742         CDS       T03271                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05160  Hepatitis C
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661742 (EGF)
   04012 ErbB signaling pathway
    103661742 (EGF)
   04014 Ras signaling pathway
    103661742 (EGF)
   04015 Rap1 signaling pathway
    103661742 (EGF)
   04630 JAK-STAT signaling pathway
    103661742 (EGF)
   04066 HIF-1 signaling pathway
    103661742 (EGF)
   04068 FoxO signaling pathway
    103661742 (EGF)
   04020 Calcium signaling pathway
    103661742 (EGF)
   04072 Phospholipase D signaling pathway
    103661742 (EGF)
   04151 PI3K-Akt signaling pathway
    103661742 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103661742 (EGF)
   04540 Gap junction
    103661742 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103661742 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661742 (EGF)
   05231 Choline metabolism in cancer
    103661742 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103661742 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103661742 (EGF)
   05212 Pancreatic cancer
    103661742 (EGF)
   05226 Gastric cancer
    103661742 (EGF)
   05214 Glioma
    103661742 (EGF)
   05218 Melanoma
    103661742 (EGF)
   05219 Bladder cancer
    103661742 (EGF)
   05215 Prostate cancer
    103661742 (EGF)
   05213 Endometrial cancer
    103661742 (EGF)
   05224 Breast cancer
    103661742 (EGF)
   05223 Non-small cell lung cancer
    103661742 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103661742 (EGF)
   05165 Human papillomavirus infection
    103661742 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103661742 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103661742 (EGF)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103661742 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Plasmod_Pvs28 Tme5_EGF_like
Other DBs
NCBI-GeneID: 103661742
NCBI-ProteinID: XP_008687650
UniProt: A0A384BZR2
LinkDB
Position
Un
AA seq 1155 aa
MLLFLIILLPVVFQCSFASLSVLQRWNCPGGSPSGRGNSTCVGPAPFLIFSHGSSIFRID
LGGTNHEQLVADAGVSVIMDFHYNEGRIYWVDLERKLLQRVFLNGTRQESICNIEKNVSG
MAVNWINEELIWSNQQEGIITVTDMKGDNSRVLLSALNYPANVAIDPVERFIFWSSEVAG
SLHRADLNGVEEKILLKTSARITAVSLDVLDKRLFWIQYNRDESNSYICSCNYDGGSVHF
SKHLTQHNLFAVSLFGDRIFYSAWKKKTIWIANKHTGKDMVKINLDPSFVPPGGIKVVHP
LLQPKAERGTQAPDQRLCKWRKGNCRGGMCGQDSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNTSKCSHDCVLTSDGPV
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRRMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEAVDVPEGLAIDWIDRKFYWTDRGKSFIEGSDLSGKHREIIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSNLVWPSGITIDYLTDKLYWCD
AKLSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGAQPCLHQNGGCEHICKERFGTAQCLCREGFVKAPDGKMC
LALNGHQIPAGNEADQVTPLDVLSRNRGFEDNITESQHLLVAEIMVSDADDCGPVGCSTR
AQCVSEGDNATCQCLKGFTGDGKLCFDIDECETGTTVCPPTSSKCVNTEGGYVCRCSEGY
RGDGIHCLDINECQLGMHTCGENATCTNTEGNYTCMCAGSLSEPGRICADSTPPSHLMED
GRHSVRNSYRECPSSYEGYCLYNGVCMYIEAVDRYACKTKKLPSKNLKNPYEESSREVSS
SRPTDNEARMASCPQPWFVVIKEHQNLRNGSQPMAVKDGEVADVSQSSSLEPGSVQQTSW
RNEPQVSMGAEQGCHPPPSSDRGSGPQAMEQSFPLPSYGARPIALGIEKPHSLLSGNPYX
QQRAPDPPHQKKRTW
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgctgctcttcctcatcattctgttgccggtagtttttcagtgtagttttgctagtctc
tcagtcctgcaacgctggaactgtcctggaggctctccctcaggaagggggaattctact
tgtgtgggtcctgcacccttcttgattttctcccatggaagcagtatctttaggattgac
ctgggaggaactaatcatgagcaattggtggcagatgctggcgtatcagtgatcatggat
tttcattacaatgagggaagaatctattgggtagatttagagagaaaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagcatatgcaatatagagaaaaatgtttcagga
atggcagtaaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggagacaattcccgagttctcttaagcgccttaaattatcct
gcaaatgtagcaattgatccagtagaaaggtttatattttggtcgtcagaggtggctggc
agccttcacagagccgatctcaacggtgtggaagagaagattctgttaaagacgtcagca
agaataacagctgtgtcattggatgtgcttgataagcggcttttttggattcagtacaac
agagatgaaagcaattcttatatttgttcctgtaattatgatggaggttctgtccatttt
agcaaacatctcacacagcacaatttgtttgcagtgtccctttttggtgatcggatcttc
tattcagcatggaaaaagaagacaatttggatagctaacaaacacaccgggaaggatatg
gttaaaattaacctcgacccatcgtttgtaccacctggcggaatcaaagtagtgcatccg
ctcttgcagcccaaggcagagaggggtactcaggcacctgatcagagactctgcaaatgg
aggaaaggtaactgcagaggcggcatgtgtggtcaagactcgaagtcccatctgtgcaca
tgtgcagaaggatatactttaagccaagatggaaagtactgtgaagatgtcaatgaatgt
gccttttggaaccatggctgtactcttgggtgtgaaaacatccctggatcttattattgc
acatgtcctgtaggatttattctgcttcctgatgggaaacggtgtcatcaattaatttcc
tgtccaagcaatacttctaaatgtagccatgactgtgttctgacatcagatggtcctgta
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtagtggctgttcc
tcacctgataatggtggatgcagccagctctgcctccctctcagccctgtctcctgggag
tgtggttgctttcctgggtatgacctccaactggacaagaaaagctgtgtggcgtcagga
ccacagccatttttgctgtttgctaattctcaagatattcgacgcatgcattttgatgga
acagattatggaaccctgctcagccagcaaatgggaatggtttttgcccttgatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaagcagtagatgtgcctgaaggtctt
gccatcgattggattgaccgtaaattctactggacagacagagggaaatctttcattgaa
gggagtgatttaagtggaaaacatcgtgaaataatcatcaaggaggacatctctcagcca
cgaggaattgctgtccatccaatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttctcttcaaggcattggccgactggttatagctagttccaat
ctggtctggcccagtggaataacaattgattacttaactgacaaactgtattggtgtgat
gccaagctgtctgtgatcgaaatggccaatctggatggttcaaaacgccaaaggcttgcc
cagaacgatgtagggcacccctttgctgtggctgtgtttgaggatcatgtgtggttctcg
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccttcatcactggttgtagttcatccattggcaaaacca
ggagcacagccctgcttacatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaactgctcagtgtttgtgtcgcgaaggttttgtgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatcagataccggcaggtaatgaagcagatcaagtaacaccattg
gacgtcttatccaggaacagaggatttgaagataacattacagaatctcagcatttgcta
gtggctgaaatcatggtatcagatgctgatgactgcggtcctgtgggatgcagtacacga
gctcagtgtgtttcagagggagacaatgccacatgtcagtgtttgaaaggatttactggg
gatggaaaactatgttttgatatagatgaatgtgagacgggcaccacagtttgccctcct
acctcctctaagtgtgtcaataccgaaggcggctatgtctgccggtgctcagaaggctac
cgaggcgatgggattcactgtcttgatattaatgagtgccaattgggcatgcacacctgt
ggggaaaatgccacctgtacaaatacggaggggaactacacctgcatgtgtgctggcagc
ctgtctgaacctgggcggatatgcgctgactctactccgccttctcatctcatggaagat
ggccgccattctgtgagaaatagttaccgggaatgcccctcatcctatgagggctactgc
ctctataatggtgtgtgtatgtacatcgaagcagttgacagatacgcatgcaagactaag
aagctgccatcaaaaaatttaaagaatccttacgaagagtcaagcagagaagttagcagt
agcaggcctacagacaacgaggccaggatggcctcttgtccccagccttggtttgtggtg
ataaaggaacaccaaaatctcaggaatggaagtcaacctatggctgtcaaggacggtgag
gtagcagatgttagccagtcctcctctctggagccaggctcagtgcaacagacgtcatgg
agaaatgaaccccaggtgtctatgggcgcagagcaaggctgccatcctccaccatccagt
gatagaggctctggtccccaggcaatggagcagagctttcctctcccctcctatggggca
cggcccattgctttggggatcgagaagccccattctctcctgtcaggtaacccttatngg
caacaaagggccccagatccaccacaccaaaagaagcggacttggtga

KEGG   Ursus maritimus (polar bear): 103661850
Entry
103661850         CDS       T03271                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04810  Regulation of actin cytoskeleton
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661850 (FGF2)
   04014 Ras signaling pathway
    103661850 (FGF2)
   04015 Rap1 signaling pathway
    103661850 (FGF2)
   04020 Calcium signaling pathway
    103661850 (FGF2)
   04151 PI3K-Akt signaling pathway
    103661850 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103661850 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103661850 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661850 (FGF2)
   05205 Proteoglycans in cancer
    103661850 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103661850 (FGF2)
   05218 Melanoma
    103661850 (FGF2)
   05224 Breast cancer
    103661850 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103661850 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103661850 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103661850 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103661850 (FGF2)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103661850 (FGF2)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103661850 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103661850
NCBI-ProteinID: XP_008687743
UniProt: A0A384BYT3
LinkDB
Position
Un
AA seq 243 aa
MVLYSEHSADPLEVLEEEHGMLKQQFKTIVLNETVGFDCYHHPMAAKAPQRGGRLNVARV
AQGWAGATSGELSRGRAPRAAEASAVASPLALRTSPAPGCVRAPPGTDFPPGHFKDPKRL
YCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLL
ASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMS
AKS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggtcctttattcagaacacagtgcagatcccttggaggttctggaggaagaacatggc
atgctcaagcagcagttcaaaacaattgttttaaatgagactgtaggatttgactgctac
caccatcccatggcagcaaaagctccgcagcgtggaggaagactaaatgtggctcgggtg
gcgcagggttgggctggggcgacttctggggaacttagccggggtcgagcccctagagct
gcggaggcctctgcggtcgcctccccgctcgccctccgcacctcccccgcccccggctgc
gttcgggctccccccgggaccgatttcccgcccggccacttcaaggaccccaaacggctg
tactgcaaaaacgggggcttcttcctgcgcatccaccccgacggccgagtggacggggtc
cgggagaagagcgaccctcatatcaaactgcaacttcaagcggaagagagaggggttgtg
tccatcaaaggagtatgtgcaaatcgctatcttgccatgaaggaagatggaagattactg
gcttctaaatgtgttaccgatgagtgtttcttttttgagcgactggaatctaataactac
aatacttaccggtcaaggaaatactccagttggtatgtggcactgaaacggactgggcag
tataaacttggacccaaaacaggacctgggcagaaagctatactttttcttccaatgtct
gctaagagctga

KEGG   Ursus maritimus (polar bear): 103662543
Entry
103662543         CDS       T03271                                 

Gene name
PDGFD
Definition
(RefSeq) platelet derived growth factor D
  KO
K05450  platelet derived growth factor C/D
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04810  Regulation of actin cytoskeleton
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103662543 (PDGFD)
   04014 Ras signaling pathway
    103662543 (PDGFD)
   04015 Rap1 signaling pathway
    103662543 (PDGFD)
   04020 Calcium signaling pathway
    103662543 (PDGFD)
   04072 Phospholipase D signaling pathway
    103662543 (PDGFD)
   04151 PI3K-Akt signaling pathway
    103662543 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103662543 (PDGFD)
   04540 Gap junction
    103662543 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103662543 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103662543 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    103662543 (PDGFD)
   05215 Prostate cancer
    103662543 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103662543 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103662543 (PDGFD)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103662543 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 103662543
NCBI-ProteinID: XP_008688444
UniProt: A0A384C1Y3
LinkDB
Position
Un
AA seq 365 aa
LVYTLVCANFCSYRDTSAAPQSAAIKALRNANLRRDESNHLTDLYRRDETIQVTGSGHVQ
SPRFPNSYPRNLLLTWRLRSRENTRIQLAFDHRFGLEEAENDICRYDFVEVEDVSETSTI
IRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASETNWES
VTSSVSGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPESWQEDLENLYLETPH
YRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTHVVFFPRCLLVQRCGGN
CGCGTINWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGRAKHMALVDIQLDHHERCDCICS
SRPPR
NT seq 1098 nt   +upstreamnt  +downstreamnt
ctcgtctacacgctcgtctgcgccaacttttgcagctatcgggacacttctgctgcgccg
cagagcgcagccatcaaagctttgcgcaacgccaacctcaggcgagatgagagcaatcac
ctcacagacttgtaccgaagagacgagaccatccaggtgacaggcagcggccacgtgcag
agccctcgcttccccaacagctaccccaggaatctgctcctcacatggcggctccgttcc
cgggagaacacaaggatacagctcgccttcgaccatcggttcgggctggaggaagccgag
aatgacatctgtaggtatgattttgtggaagttgaagatgtatctgaaaccagtaccata
attagaggtcggtggtgtggacacaaggaagttcctccaaggatcacatcaagaacgaac
caaattaaaataacattcaagtctgatgactactttgtggctaaacctggattcaagatt
tattattcttttgtggaagatttccaacccgcagcagcctcagagaccaactgggagtca
gtcacaagctctgtctcaggggtatcctatcactctccatcagtaacggaccccaccctc
actgcggatgctctggacaaaacagtcgcagaatttgataccgtggaagatctgctcaag
cacttcaatccagaatcatggcaagaagatcttgagaatctatatttggagaccccccat
tatcgaggcaggtcctaccatgaccggaagtcaaaagtcgacctggacaggctcaatgat
gacgtcaagcgctacagttgcactcccaggaattactccgtcaacttaagagaggagctg
aagctcacgcacgtggtcttctttccccgttgcctcctcgtgcagcgctgtgggggcaac
tgtggctgtgggaccatcaactggaaatcctgcacctgcagctccgggaaaactgtgaaa
aagtatcatgaggtattaaagtttgagcctggccatttcaagaggaggggcagagcgaag
cacatggctctcgttgacatccagttggaccaccacgagcggtgtgactgcatctgcagc
tcgagaccgcctcgataa

KEGG   Ursus maritimus (polar bear): 103663709
Entry
103663709         CDS       T03271                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04390  Hippo signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103663709 (FGF1)
   04014 Ras signaling pathway
    103663709 (FGF1)
   04015 Rap1 signaling pathway
    103663709 (FGF1)
   04390 Hippo signaling pathway
    103663709 (FGF1)
   04020 Calcium signaling pathway
    103663709 (FGF1)
   04151 PI3K-Akt signaling pathway
    103663709 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103663709 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663709 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103663709 (FGF1)
   05218 Melanoma
    103663709 (FGF1)
   05224 Breast cancer
    103663709 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103663709 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103663709 (FGF1)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103663709 (FGF1)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103663709 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103663709
NCBI-ProteinID: XP_008689675
UniProt: A0A384C499
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTANEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagtgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacagcaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

KEGG   Ursus maritimus (polar bear): 103664292
Entry
103664292         CDS       T03271                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103664292 (FGF9)
   04014 Ras signaling pathway
    103664292 (FGF9)
   04015 Rap1 signaling pathway
    103664292 (FGF9)
   04020 Calcium signaling pathway
    103664292 (FGF9)
   04151 PI3K-Akt signaling pathway
    103664292 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103664292 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664292 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    103664292 (FGF9)
   05218 Melanoma
    103664292 (FGF9)
   05224 Breast cancer
    103664292 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103664292 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103664292 (FGF9)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103664292 (FGF9)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103664292 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103664292
NCBI-ProteinID: XP_008690358
UniProt: A0A384C698
LinkDB
Position
Un
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggcttcccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacatactcctcgaatctatataaacacgtggacactggaagg
cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagttga

KEGG   Ursus maritimus (polar bear): 103664645
Entry
103664645         CDS       T03271                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103664645 (FGF10)
   04014 Ras signaling pathway
    103664645 (FGF10)
   04015 Rap1 signaling pathway
    103664645 (FGF10)
   04020 Calcium signaling pathway
    103664645 (FGF10)
   04151 PI3K-Akt signaling pathway
    103664645 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103664645 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664645 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    103664645 (FGF10)
   05218 Melanoma
    103664645 (FGF10)
   05224 Breast cancer
    103664645 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103664645 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103664645 (FGF10)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103664645 (FGF10)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103664645 (FGF10)
SSDB
Motif
Pfam: FGF Fascin SR-25
Other DBs
NCBI-GeneID: 103664645
NCBI-ProteinID: XP_008690782
UniProt: A0A384C7J2
LinkDB
Position
Un
AA seq 214 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSIPVTCQALGQDMVSPEATNSSSSSSSSSS
SSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEIT
SVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGR
QMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcctggctgctgc
tgctgcttcttgttgctgttcttggtgtcttccatccctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcctcttcttcctcctcctcctcgtcctct
tcctccttctcctctccttccagtgcggggaggcatgtgcggagctacaatcacctccaa
ggagatgtccgctggagaaagctattctcttttaccaagtactttctcaagattgagaag
aacgggaaggtcagcggtaccaagaaggagaactgcccgtacagtatcctagagataact
tcagtggaaatcggagttgttgccgtcaaagccattaacagcaactattatttagccatg
aacaagaaggggaaactctatggctcaaaagaatttaacaatgactgtaagctgaaggag
aggatagaggaaaatggatataacacatatgcatcctttaactggcagcacaatgggagg
caaatgtacgtggcattgaatggaaaaggagctcccaggagaggacagaaaacacgaagg
aaaaacacctcagcgcattttcttccaatggtggtacactcgtag

KEGG   Ursus maritimus (polar bear): 103664781
Entry
103664781         CDS       T03271                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103664781 (FGF18)
   04014 Ras signaling pathway
    103664781 (FGF18)
   04015 Rap1 signaling pathway
    103664781 (FGF18)
   04020 Calcium signaling pathway
    103664781 (FGF18)
   04151 PI3K-Akt signaling pathway
    103664781 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103664781 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664781 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    103664781 (FGF18)
   05218 Melanoma
    103664781 (FGF18)
   05224 Breast cancer
    103664781 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103664781 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103664781 (FGF18)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103664781 (FGF18)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103664781 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103664781
NCBI-ProteinID: XP_008690930
UniProt: A0A384C962
LinkDB
Position
Un
AA seq 211 aa
MYMAPLTTSPSLSRRCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLGP
LYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKL
VGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMK
RYPKGQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtacatggccccactgaccacctctccatctctctctcgcaggtgtttacacttcctg
ctgctgtgcttccaggtacaggtgctggcggccgaggagaacgtggacttccgcatccac
gtggagaaccagacgcgggctcgggacgatgtgagccgtaagcagctgcggctgggccca
ctctacagccggaccagcgggaagcacatccaggtgctgggccgcaggatcagcgcccgc
ggcgaggacggggacaagtatgcccagctcctagtggagacagacaccttcggtagtcaa
gtccggatcaagggcaaggagacggaattctacctgtgtatgaaccggaaaggcaagctc
gtggggaagcccgatggcaccagcaaggagtgtgtattcattgagaaggtcctggagaac
aactacacagccctaatgtccgccaagtactctggctggtacgtgggcttcaccaagaag
gggcggccacggaagggtcccaagacgcgagagaaccagcaggacgtgcacttcatgaag
cgctaccccaagggacaggcagagctgcagaagcccttcaagtacaccacggtgaccaag
aggtcccggcggatccgccccacgcaccccggctag

KEGG   Ursus maritimus (polar bear): 103665349
Entry
103665349         CDS       T03271                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665349 (FGF5)
   04014 Ras signaling pathway
    103665349 (FGF5)
   04015 Rap1 signaling pathway
    103665349 (FGF5)
   04020 Calcium signaling pathway
    103665349 (FGF5)
   04151 PI3K-Akt signaling pathway
    103665349 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103665349 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665349 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    103665349 (FGF5)
   05218 Melanoma
    103665349 (FGF5)
   05224 Breast cancer
    103665349 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103665349 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103665349 (FGF5)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103665349 (FGF5)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103665349 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103665349
NCBI-ProteinID: XP_008691494
UniProt: A0A384CAK8
LinkDB
Position
Un
AA seq 284 aa
MSLSFLLLLFLSHLILSAWAHGEKHLAPKGQPGPAATGRNPGGASSSRSSSGTTSSSSSS
DSSSPGASLGSQGSGLEQTSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANML
SILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASENGFLPNRSRSQVKAKFTDDCKFRE
RFQENSYNTYASAIHRTEPAGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQVEQ
PELSFTVTVPEKKKPPSPVKPKVPVSAPRKSPNTVKYRLKFRFG
NT seq 855 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcctcagccacctaatcctcagcgcctgggct
cacggggagaagcacctcgcccccaaagggcaacccggacccgctgccaccggtcggaac
ccgggaggcgccagcagcagccggagcagcagtggcacgacgtcttcctcttcttcctcc
gactcctcctcccccggggcttctctgggcagccaagggagcggcttggagcagaccagt
ttccagtggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggt
ttccatctgcagatctacccggatggcaaagtcaatggctcccatgaagccaatatgtta
agtattttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagc
aacaaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgaaaatggatttttg
ccaaacaggagtagaagtcaggtcaaggccaaatttacagatgattgcaagttcagggag
cgatttcaagaaaacagctataatacctatgcctcagcaatacacagaactgagccagcg
ggccgggagtggtacgtggccctcaataagagagggaaggccaagcggggctgcagcccc
cgggtcaaaccccagcacatctccacccactttctgccaagattcaagcaggtagagcag
ccagaactttctttcacagttactgttcctgagaagaaaaagccacccagtccagtcaag
ccaaaggttcccgtgtccgcccctcggaagagtcccaacaccgtgaaatacagactcaag
tttcgctttggataa

KEGG   Ursus maritimus (polar bear): 103670054
Entry
103670054         CDS       T03271                                 

Gene name
PDGFA
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103670054 (PDGFA)
   04014 Ras signaling pathway
    103670054 (PDGFA)
   04015 Rap1 signaling pathway
    103670054 (PDGFA)
   04630 JAK-STAT signaling pathway
    103670054 (PDGFA)
   04020 Calcium signaling pathway
    103670054 (PDGFA)
   04072 Phospholipase D signaling pathway
    103670054 (PDGFA)
   04151 PI3K-Akt signaling pathway
    103670054 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103670054 (PDGFA)
   04540 Gap junction
    103670054 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103670054 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670054 (PDGFA)
   05202 Transcriptional misregulation in cancer
    103670054 (PDGFA)
   05206 MicroRNAs in cancer
    103670054 (PDGFA)
   05231 Choline metabolism in cancer
    103670054 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    103670054 (PDGFA)
   05218 Melanoma
    103670054 (PDGFA)
   05215 Prostate cancer
    103670054 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103670054 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103670054 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670054 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103670054 (PDGFA)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103670054 (PDGFA)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103670054 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 103670054
NCBI-ProteinID: XP_008696669
UniProt: A0A384CQA9
LinkDB
Position
Un
AA seq 241 aa
MGSSSGAYAAGGPGILHTPVCEPRDEYHRSNSASARRGAPETPEIARKHRLRGRPDIPAS
RQPSKAQQGCHAGGDPRGGFPEVGGRFLAVGSLSSSAHVGVAGLSGDPVCLGEAGRTHRW
TGPRTPHRCGPAGHRFLLLPVGAEDALEASLRAHGGHASKRAPEKRPMPIRRKRSIEEAI
PAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRVHHPHTRK
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggctccagttctggtgcctatgctgctgggggacccggcatccttcacactcctgtc
tgtgagcctcgggacgagtaccaccggagtaattccgcttctgcacgtcggggcgcgccg
gagacgcccgagatagcccggaagcaccggctccgggggcgaccggacatcccggccagt
cgccagcctagcaaagcacagcaggggtgccacgctgggggggacccccgtggaggcttc
cccgaggttggcgggagatttttggcagttgggagtctttcatcctctgcccacgtggga
gtggcgggcctctcaggggaccctgtctgtctgggggaggcaggtaggacgcaccgctgg
acaggccccaggacgccacacagatgcgggccagctggtcaccgtttcctcctcctgcct
gtaggggccgaggatgctttggaagcgagtctgagagcccacgggggccatgccagcaag
cgtgcacccgagaagaggcccatgcccatccgaaggaaaagaagcatcgaggaagccatc
ccggcggtctgcaagaccaggacggtcatttatgagatacctcggagccaggtcgacccc
acgtctgccaacttcctgatctggcccccgtgcgtggaggtgaagcgctgtgccgggtgc
tgtaacaccagcagcgtcaagtgccagccctcccgcgtccaccacccgcacaccaggaag
gcgtag

KEGG   Ursus maritimus (polar bear): 103671137
Entry
103671137         CDS       T03271                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671137 (FGF3)
   04014 Ras signaling pathway
    103671137 (FGF3)
   04015 Rap1 signaling pathway
    103671137 (FGF3)
   04020 Calcium signaling pathway
    103671137 (FGF3)
   04151 PI3K-Akt signaling pathway
    103671137 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103671137 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671137 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    103671137 (FGF3)
   05218 Melanoma
    103671137 (FGF3)
   05224 Breast cancer
    103671137 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103671137 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103671137 (FGF3)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103671137 (FGF3)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103671137 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103671137
NCBI-ProteinID: XP_008697933
UniProt: A0A384CT25
LinkDB
Position
Un
AA seq 224 aa
MSAFPVLEHSGARTGAKHDTPASAGDNLTPTPTGLQTELEKVRGLVGGLTSGSWSSWALR
KEVVGSAGPMPVLPATLALEAEDLLGCHAAVDRLVAKAEEGLILPELRLGILEMTAVEVG
IVAIKGLFSGRYLAMNKRGRLYASESYNAECEFVERIHELGYNTYASRLYRTAPSGPGAQ
RQPSAERLWYVSVNGKGRPRRGFKTRRTQKVALFGNRVIANVIK
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcagccttccccgttttggagcactccggggccaggacgggtgccaagcatgacacg
ccagcctcggccggagacaacctcacgccgacacccaccggtttacaaactgagctggag
aaggttcggggacttgtcggaggcctcacgtcaggcagctggagcagctgggccctgaga
aaggaagtcgtggggtcagctggacccatgcctgtcctgcctgccacgctggccctcgaa
gctgaggaccttctggggtgccacgccgccgtggacaggttggtagccaaggcagaagag
ggactcatcctgccagaacttaggctcggtatcctggagatgacagcggtggaggtgggc
atcgtggccatcaaggggctcttctccgggcggtacctggccatgaacaagagggggcgg
ctctatgcttcggagagctacaacgccgagtgtgagttcgtggagcggatccacgagctg
ggctacaacacgtacgcctcgcggctgtaccgcacagcgcccagcggcccgggggcccag
cggcagcccagcgccgagagactgtggtatgtgtccgtgaacggcaagggcaggccccgc
aggggcttcaagacgcgccgcactcagaaggtggccttatttggaaatagggtcattgca
aatgtaatcaagtag

KEGG   Ursus maritimus (polar bear): 103671138
Entry
103671138         CDS       T03271                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671138 (FGF19)
   04014 Ras signaling pathway
    103671138 (FGF19)
   04015 Rap1 signaling pathway
    103671138 (FGF19)
   04020 Calcium signaling pathway
    103671138 (FGF19)
   04151 PI3K-Akt signaling pathway
    103671138 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103671138 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671138 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    103671138 (FGF19)
   05218 Melanoma
    103671138 (FGF19)
   05224 Breast cancer
    103671138 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103671138 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103671138 (FGF19)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103671138 (FGF19)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103671138 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103671138
NCBI-ProteinID: XP_008697934
UniProt: A0A384CTX3
LinkDB
Position
Un
AA seq 178 aa
GEPIRLRHLYTAGPHGLSSCFLRIRADGGVDCARGQSAHSLVEIRAVALRTVAIKGVHSV
RYLCMGADGRMQGLPQYSAGDCAFEEEIRPDGYNVYRSKKHRLPVSLSSAKQRQLYKDRG
FLPLSHFLPMLPGSPAEPRELQDHAESDGFSAPLETDSMDPFGIAAKMGLVKSPSFQK
NT seq 537 nt   +upstreamnt  +downstreamnt
ggtgagcccatccgcctacggcacctgtacaccgccggcccccacggcctctccagctgc
ttcctgcgcatccgtgccgacggcggggttgactgcgcgcggggccagagcgcgcacagt
ttggtggagatcagggcagtcgctctgcggaccgtggccatcaagggcgtgcacagcgtc
cggtacctctgcatgggcgccgacggcaggatgcaagggctgcctcagtactccgcgggg
gactgtgctttcgaggaggagatccgccccgacggctacaatgtgtaccggtccaagaag
caccgtctccctgtctctctgagcagcgccaaacagaggcagctgtacaaggacagaggc
tttctgcccctgtcccacttcttgcccatgctgcctgggagcccagcagagcccagggaa
ctccaggaccacgcggagtcggacgggttttctgcacccctagaaacagacagcatggac
ccttttgggatcgccgccaaaatgggactagtgaagagtcccagcttccagaaataa

KEGG   Ursus maritimus (polar bear): 103673325
Entry
103673325         CDS       T03271                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103673325 (FGF17)
   04014 Ras signaling pathway
    103673325 (FGF17)
   04015 Rap1 signaling pathway
    103673325 (FGF17)
   04020 Calcium signaling pathway
    103673325 (FGF17)
   04151 PI3K-Akt signaling pathway
    103673325 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103673325 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673325 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    103673325 (FGF17)
   05218 Melanoma
    103673325 (FGF17)
   05224 Breast cancer
    103673325 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103673325 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103673325 (FGF17)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103673325 (FGF17)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103673325 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103673325
NCBI-ProteinID: XP_008700315
UniProt: A0A384D0P6
LinkDB
Position
Un
AA seq 216 aa
MGATRLLPRLALCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKKGKLVGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccacccgcctgctgccccgcctcgctctgtgtctgcaactactgattctctgc
tgtcaaacccagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgccatgaccgaccagctgagcaggcggcagatccgcgagtaccagctctacagccgg
accagcggcaagcacgtgcaggtcaccgggcgtcgcatctctgccactgcggaggacggc
aacaagtttgccaaactcatagtggagacggacacctttggaagccgtgtgcgcatcaag
ggtgctgagagtgagaaatacatctgtatgaacaagaagggcaagctcgttggaaagccc
agcgggaagagcaaagactgcgtgttcacggagatcgtgctggagaacaactacacggcc
ttccagaatgcccggcacgagggatggttcatggccttcaccaggcagggtcggccccgc
caggcttctcgaagccgccagaaccaacgagaggctcacttcatcaagcgcctctaccag
ggccagttgcccttccccaaccacgcagagaggcagaagcagttcgagttcgtgggctca
gcccccacccgccggaccaagcgcactcggaggccacagcccctgacgtag

KEGG   Ursus maritimus (polar bear): 103675745
Entry
103675745         CDS       T03271                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103675745 (FGF23)
   04014 Ras signaling pathway
    103675745 (FGF23)
   04015 Rap1 signaling pathway
    103675745 (FGF23)
   04020 Calcium signaling pathway
    103675745 (FGF23)
   04151 PI3K-Akt signaling pathway
    103675745 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103675745 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103675745 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675745 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    103675745 (FGF23)
   05218 Melanoma
    103675745 (FGF23)
   05224 Breast cancer
    103675745 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103675745 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103675745 (FGF23)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103675745 (FGF23)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103675745 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103675745
NCBI-ProteinID: XP_008703099
UniProt: A0A384D8I9
LinkDB
Position
Un
AA seq 318 aa
MWTVEFFLFDVTRLPFKSPRGKRRESSLGSSGQIPTKKRRKRPARHSQGVREAVSGFKLQ
PAIQSAAMSGTRLGLLVSVLCWVVRAYPNTSPLLGSSWGGLTHLYTASARNSYHLQIHKD
GHVDGTPHQTIYSALIIRSEDAGFVVITGVMSRRYLCMDLRGNIFGSVSFFFVPGEARSS
TWFRQRTLENGYDVYHSPQHRFLVSLGQAKRTFLPGTNPPPYSQFLSRRNEIPLIHFNTP
RPRRHTRSAEDTERDPLNVLKPRPRMTPAPASCSQELPSAEDNSVVASDPLGVLRGNRVN
AHAGGMGVDRCRPFPKFI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggacagtggagtttttcctgtttgatgtcacacggctaccctttaaaagtccaagg
ggaaaaaggagggaatccagcctaggatcctcaggccagatacccacaaagaagagaaga
aagaggcctgcgaggcacagccagggagtcagggaggcagtgtcaggtttcaaactccag
ccagccattcagagcgctgcgatgtccgggacccgccttgggctcctggtctctgtcctg
tgctgggtagtcagagcgtatcccaacacctccccgctgctcggctccagctggggtggc
ctgacccacctgtacacagccagcgccaggaacagctaccacctgcagatccacaaggac
ggccatgtggatggcacaccccatcagaccatctacagtgccctgataatcaggtcagag
gatgccggctttgtggtgataacaggtgtgatgagtaggcgatacctctgtatggacctc
agaggcaacatctttggatccgtgagtttcttttttgtgccgggcgaagccaggtccagc
acctggttccgacagcggacgctggaaaacggctacgacgtgtaccactccccgcagcac
cgcttcctcgtcagcctgggccaggccaagaggaccttcctgccagggaccaacccgccg
ccctactcccagttcctgtcccggaggaacgagatccccctcatccacttcaacaccccc
aggccaaggcggcacacgcgcagcgccgaggacacggagcgcgacccactgaacgtgctg
aagcccaggccccgcatgacccccgccccggcctcctgctcccaggagctccctagcgcc
gaggacaacagtgtggtggccagcgacccgttaggggtactcagaggcaaccgggtgaac
gcgcacgccggggggatgggcgtggacaggtgccgccccttccccaagttcatctag

KEGG   Ursus maritimus (polar bear): 103675746
Entry
103675746         CDS       T03271                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103675746 (FGF6)
   04014 Ras signaling pathway
    103675746 (FGF6)
   04015 Rap1 signaling pathway
    103675746 (FGF6)
   04020 Calcium signaling pathway
    103675746 (FGF6)
   04151 PI3K-Akt signaling pathway
    103675746 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103675746 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675746 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    103675746 (FGF6)
   05218 Melanoma
    103675746 (FGF6)
   05224 Breast cancer
    103675746 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103675746 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103675746 (FGF6)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103675746 (FGF6)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103675746 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103675746
NCBI-ProteinID: XP_008703100
UniProt: A0A384D8J1
LinkDB
Position
Un
AA seq 208 aa
MALGQRLFITMSPGAGRLQGTLQALVFLGVLVGMVVPSPAGTRANSTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtccccgggagcaggacgtcttcagggc
acgctgcaggctctcgtcttcctaggcgtcctagtgggcatggtggtgccctcgcctgca
ggcacccgggccaacagcacgctgctggactccaggggctggggcaccctgctatcaagg
tctcgagccggactagctggagagattgctggggtgaattgggagagtggctatttggtg
gggatcaagcggcagaggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ccccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggagatt
tccacagtggagcggggtgtggtgagtctctttggagtgaaaagtgccctcttcgttgcc
atgaacagtaaagggagattatatgcaacgcccagcttccaagaggaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacctgtaccgagggacctac
atcgcactgagcaaatacggacgggtaaagcgaggcagcaaggtgtccccaatcatgact
gtcactcacttccttcccaggatataa

KEGG   Ursus maritimus (polar bear): 103675826
Entry
103675826         CDS       T03271                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103675826 (FGF16)
   04014 Ras signaling pathway
    103675826 (FGF16)
   04015 Rap1 signaling pathway
    103675826 (FGF16)
   04020 Calcium signaling pathway
    103675826 (FGF16)
   04151 PI3K-Akt signaling pathway
    103675826 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103675826 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675826 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    103675826 (FGF16)
   05218 Melanoma
    103675826 (FGF16)
   05224 Breast cancer
    103675826 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103675826 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103675826 (FGF16)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103675826 (FGF16)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103675826 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103675826
NCBI-ProteinID: XP_008703181
UniProt: A0A384D894
LinkDB
Position
Un
AA seq 184 aa
MRELTLEAQQQFVRAKEITEGSSRVSYRQLTASCGFKDMGAKRVQNKVSLEGNEFDINNR
NGIHFLALGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENW
YNTYASTLYKHLDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDL
FRYK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgagggaactaacacttgaagctcagcagcagtttgtccgagcaaaggaaataaccgaa
ggctccagcagagtcagctacaggcagttgacagcctcatgtggctttaaggacatggga
gctaagagggtgcaaaacaaagtcagcctagagggcaacgagtttgacatcaataataga
aacggcattcactttcttgctctaggaatcctggagtttatcagcctggctgtggggttg
atcagcatccggggagtggactctggcctgtacttaggaatgaatgagcgaggagaacta
tatgggtcgaagaaactcacacgtgaatgtgttttccgggaacaatttgaagaaaactgg
tacaacacctatgcttccaccttgtacaaacacttggactcggagagacagtattatgtg
gccttgaataaagacggctcaccccgggagggatacaggactaaacgacaccagaaattc
actcactttttgcccaggccagtagatccttctaagttgccctccatgtccagagacctc
ttccgttataagtaa

KEGG   Ursus maritimus (polar bear): 103676495
Entry
103676495         CDS       T03271                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04114  Oocyte meiosis
umr04115  p53 signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676495 (IGF1)
   04014 Ras signaling pathway
    103676495 (IGF1)
   04015 Rap1 signaling pathway
    103676495 (IGF1)
   04066 HIF-1 signaling pathway
    103676495 (IGF1)
   04068 FoxO signaling pathway
    103676495 (IGF1)
   04151 PI3K-Akt signaling pathway
    103676495 (IGF1)
   04152 AMPK signaling pathway
    103676495 (IGF1)
   04150 mTOR signaling pathway
    103676495 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103676495 (IGF1)
   04115 p53 signaling pathway
    103676495 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676495 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103676495 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103676495 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    103676495 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    103676495 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103676495 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    103676495 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103676495 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    103676495 (IGF1)
   04213 Longevity regulating pathway - multiple species
    103676495 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676495 (IGF1)
   05202 Transcriptional misregulation in cancer
    103676495 (IGF1)
   05205 Proteoglycans in cancer
    103676495 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    103676495 (IGF1)
   05218 Melanoma
    103676495 (IGF1)
   05215 Prostate cancer
    103676495 (IGF1)
   05224 Breast cancer
    103676495 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103676495 (IGF1)
   05414 Dilated cardiomyopathy
    103676495 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676495 (IGF1)
   01522 Endocrine resistance
    103676495 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103676495 (IGF1)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103676495 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 103676495
NCBI-ProteinID: XP_008703915
UniProt: A0A384DAX3
LinkDB
Position
Un
AA seq 184 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVL
CVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRA
QRHTDMPKAQKYRPPSTTKKTKSQRRRKGGPKKRPGGEQKVGTETSQQMKGKKKEQRRET
GARN
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcctcctcgcatctcttctacctggccctgtgcttgctc
accttcaccagctctgccacagctggaccggagacgctctgtggggctgaattggttctg
tgtgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggctccagcagt
cggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgtgatctgagg
aggctagagatgtactgcgcacccctcaagcctgccaagtctgcccgctcagtccgtgcc
cagcgccacactgacatgcccaaggctcagaagtatcgtcccccatctaccaccaagaaa
acgaagtctcagaggagaaggaaaggtgggccaaagaaacgcccaggaggggaacagaag
gtggggacggaaacaagtcagcagatgaaaggaaagaagaaagagcagagaagggagact
ggagctagaaactga

KEGG   Ursus maritimus (polar bear): 103676520
Entry
103676520         CDS       T03271                                 

Gene name
PDGFB
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676520 (PDGFB)
   04014 Ras signaling pathway
    103676520 (PDGFB)
   04015 Rap1 signaling pathway
    103676520 (PDGFB)
   04630 JAK-STAT signaling pathway
    103676520 (PDGFB)
   04020 Calcium signaling pathway
    103676520 (PDGFB)
   04072 Phospholipase D signaling pathway
    103676520 (PDGFB)
   04151 PI3K-Akt signaling pathway
    103676520 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676520 (PDGFB)
   04540 Gap junction
    103676520 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103676520 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676520 (PDGFB)
   05206 MicroRNAs in cancer
    103676520 (PDGFB)
   05231 Choline metabolism in cancer
    103676520 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    103676520 (PDGFB)
   05218 Melanoma
    103676520 (PDGFB)
   05211 Renal cell carcinoma
    103676520 (PDGFB)
   05215 Prostate cancer
    103676520 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676520 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676520 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676520 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103676520 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103676520 (PDGFB)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103676520 (PDGFB)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103676520 (PDGFB)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 103676520
NCBI-ProteinID: XP_008703950
UniProt: A0A384DB11
LinkDB
Position
Un
AA seq 332 aa
MSGYQGQTVETVRGDQIKVSYSQEPGDAVSLRVPWSSQELYPTRRLDASAQKGSDLPKVT
QLLSSQAGCEEAAKRESFTATPVSGCECRPRGCGFGLLAGDPIPEELYEMLSDHSIRSFD
DLQRLLHGASVDEDGAELDLNLTRSHSGGELESLSRGRRSLGEAADENGDPSMVGARQGE
LGYEKGRGQGPAIVWARASPLPAFGFRGKIPAGDTGVGRVGRRAPSAPACVVLQRHLDGS
VLQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVAARPVTRSLGSTQEQRAKTPQTRVT
IRTVRVRRPPKGKHRKFKHTHDKKALKETLGA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtctgggtaccaagggcagacggtggagacagtgcgaggggaccagataaaggtgtcc
tacagccaggagcccggcgatgcagtgagcctgcgggtcccgtggtcctcccaagaactc
tatcccactcggaggctagatgcaagtgcacagaaaggaagtgacttgcccaaggtgacc
cagctcctcagcagccaggcaggatgcgaagaagctgcaaagcgtgagtccttcaccgct
acgcccgtgtcagggtgcgagtgccgccctcggggctgcgggtttggactcctggcgggg
gaccccattcccgaggagctctacgagatgctgagtgaccactcgatccgctcctttgat
gacctccagcgtctgctgcacggagcctccgtagacgaagacggggccgagctggacctg
aatttgacccgatcccattctggaggcgagctggagagcttatcccgagggagaaggagc
ctaggtgaggctgcagatgagaatggtgacccctccatggtgggagccagacaaggagaa
ctgggctacgagaagggcagagggcaaggtcctgctattgtttgggccagggcctctcca
ctcccggctttcggctttcgaggaaagatccctgcgggggacactggggtaggaagagta
ggcaggcgggctccctcagcccctgcctgtgtggtcttacagaggcacttggatggttct
gtccttcaggtgagaaaaatcgagattgtacggaagaagccaacctttaagaaggccacg
gtgaccctggaggaccacctggcgtgcaagtgtgagacagtggtggctgctcgacctgtg
acccgaagcctggggagtacccaggagcagcgagccaagacaccccaaactcgggtgacc
attcggacggtgcgagtccgccggccccccaaggggaagcaccggaagttcaagcacacg
catgacaagaaggcgctgaaggagaccctcggagcctag

KEGG   Ursus maritimus (polar bear): 103676724
Entry
103676724         CDS       T03271                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676724 (FGF7)
   04014 Ras signaling pathway
    103676724 (FGF7)
   04015 Rap1 signaling pathway
    103676724 (FGF7)
   04020 Calcium signaling pathway
    103676724 (FGF7)
   04151 PI3K-Akt signaling pathway
    103676724 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103676724 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676724 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    103676724 (FGF7)
   05218 Melanoma
    103676724 (FGF7)
   05224 Breast cancer
    103676724 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103676724 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103676724 (FGF7)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103676724 (FGF7)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103676724 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103676724
NCBI-ProteinID: XP_008704162
UniProt: A0A384DAU4
LinkDB
Position
Un
AA seq 194 aa
MRKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacatacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtatctgaggattgat
aaacgaggcaaagtcaaaggaacccaagagatgaagaacagttacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgca
atgaataaagaaggaaaactctatgcaaagaaagaatgcaatgaagattgcaacttcaaa
gaattaattctggaaaaccattacaacacatatgcatcagctaaatggacacacagcgga
ggagaaatgtttgttgctttaaaccaaaagggggttcctgtaagggggaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacataa

KEGG   Ursus maritimus (polar bear): 103681372
Entry
103681372         CDS       T03271                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103681372 (FGF20)
   04014 Ras signaling pathway
    103681372 (FGF20)
   04015 Rap1 signaling pathway
    103681372 (FGF20)
   04020 Calcium signaling pathway
    103681372 (FGF20)
   04151 PI3K-Akt signaling pathway
    103681372 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103681372 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103681372 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    103681372 (FGF20)
   05218 Melanoma
    103681372 (FGF20)
   05224 Breast cancer
    103681372 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103681372 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103681372 (FGF20)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103681372 (FGF20)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103681372 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103681372
NCBI-ProteinID: XP_008709157
UniProt: A0A384DQ18
LinkDB
Position
Un
AA seq 215 aa
MNQIKKKDERKVGFAELEPQPPAPAGYWQRQLIDVPAKPAAGSHLPKERRSLQDSENSPA
ISVQSPLSDLTGLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSG
LYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPR
DGARSKRHQKFTHFLPRPVDPERVPELYKDILMYS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaccaaattaagaagaaggacgagcgaaaagttgggtttgcggagttggagcctcag
cccccagccccagccgggtattggcagcggcagcttatagatgttcctgcaaagccagca
gccggctcccacctccccaaggagagaagatcgctccaagacagtgaaaactcccctgct
atctcagtgcaaagtccactcagcgacctcacaggactctactgccgcacgggcttccac
ctgcagatcttgccggacggcagcgtgcagggcacccggcaggaccacagcctcttcggt
atcctggaattcatcagtgtggcagtgggactggtcagtattagaggtgtggacagtggt
ctttaccttggaatgaatgacaaaggagaactctatggctcagagaaattgacttctgaa
tgcatctttagggagcaatttgaagagaactggtataatacctattcatccaacatatat
aaacatggggacactggccgtaggtattttgtggcacttaacaaagacggaactccaaga
gatggtgccaggtccaaaagacatcagaaattcacacatttcctgcctagaccagtggat
ccagagagagttcccgaattgtacaaggacatcctgatgtacagctga

DBGET integrated database retrieval system