KEGG   Ursus maritimus (polar bear): 103657110Help
Entry
103657110         CDS       T03271                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04910  Insulin signaling pathway
umr04922  Glucagon signaling pathway
umr04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103657110 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103657110 (GYS1)
   04152 AMPK signaling pathway
    103657110 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103657110 (GYS1)
   04922 Glucagon signaling pathway
    103657110 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    103657110 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103657110 (GYS1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103657110 (GYS1)
Glycosyltransferases [BR:umr01003]
 Polysaccharide
  Storage polysaccharide
   103657110 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103657110
NCBI-ProteinID: XP_008682748
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAEVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKKTLDSMNSKGCKVYFGRWLIEGSPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSGADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDVDGERYDEDEEAAKDRRNIRAPEWPRRASSASSTGGSKRSSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagtcgcactttgtccatgtcctccctgccaggactggaggattgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggaggcatctacacggtcctgcagacgaaggcggaggtgacaggggatgagtggggtgac
aactactacctggtgggaccttacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccaacgccggccctgaagaagacgctggactccatgaacagcaagggctgcaag
gtgtactttggtcgctggctgatcgaggggagccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcacgacctgg
ttcctgggtgagttcctggcccagaatgaggagaagccacatgtggttgcacacttccac
gagtggttggcgggcatcggactctgcctgtgccgggcccggcggctgcctgtggctaca
atcttcaccacccacgccacgctcctgggacgatatctgtgtgcgggtgctgtggatttc
tacaacaacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcggcccactgcgctcacgtctttactactgtgtcccag
attaccgccatcgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
gggctgaatgtgaaaaagttctccgccatgcatgagttccagaacctccatgctcaaagc
aaggctcgaatccaggagtttgtgcggggccacttttatggacacctggacttcaacttg
gacaagaccttgtatttctttatcgccggccgctacgagttctctaacaagggggccgac
gtcttcctagaggccttggcccggctcaactatctgctcagagtgaacggcagtgagcag
acggtcgttgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctc
aagggccaggccgtgcgcaagcagctctgggatacggccaacactgtgaaagagaagttt
ggaaggaagctttacgaatccttgctggtggggagcctcccggacatgaataagatgctg
gacaaggaggacttcaccatgatgaagagagccatctttgccacgcagcggcagtccttc
ccccctgtgtgcacccacaacatgctggacgactcctcggaccctatcctgaccaccatc
cgccgaattggactcttcaatagtggtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggattatgaggaatttgtccgtggctgc
catcttggggtcttcccctcctactatgagccttggggctacacgccagctgagtgcacg
gttatgggtatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcttacggcatctacattctggaccggcggttccgtagtctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcgaaaccgcaccgagcgcctctcagaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgactcagggctaccgctacccacggccggcc
tcggtgccaccatcgccctcgctgtcgcgacactcaagcccacaccagagtgaggacgag
gaggagccccgggacgggccgccggatgtagacggggagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgaatggccgcgccgcgcctccagcgcc
tcttccaccggcggaagcaagcgcagctcggtggacacggcgccctccagctcgctcagc
actcccagtgagcccctcagccctgccagctccctgggcgaggagcgcaactga

DBGET integrated database retrieval system