KEGG   Ursus maritimus (polar bear): 103657224Help
Entry
103657224         CDS       T03271                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03030  DNA replication
umr03410  Base excision repair
umr03420  Nucleotide excision repair
umr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103657224 (LIG1)
   03410 Base excision repair
    103657224 (LIG1)
   03420 Nucleotide excision repair
    103657224 (LIG1)
   03430 Mismatch repair
    103657224 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103657224 (LIG1)
   03400 DNA repair and recombination proteins [BR:umr03400]
    103657224 (LIG1)
Enzymes [BR:umr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103657224 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103657224 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103657224 (LIG1)
DNA replication proteins [BR:umr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103657224 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103657224 (LIG1)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103657224 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     103657224 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     103657224 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 103657224
NCBI-ProteinID: XP_008682873
UniProt: A0A384BJU1
LinkDB All DBs
Position
Un
AA seq 888 aa AA seqDB search
MQRSIMSFFYPKKEGKVKKPEKETSNSVRETEPPPKVALKERNGEVPENDSPVKRPGRKV
ARVLSSEGEEEDEALTPSKGQKPAPGSPQVSPPSPATFPESSPSLSNTSPVDISPSGIPK
RRTARKQLPKRTIQDVLEEQGKEEDREAKRKKEEEAETSPESLTEPEVTQKKEAEGDRPM
TPPETSPAEPPPDGASEPEVAEKQQAREEDPAKPPARAPKPVSSFFAPRKPCEKVRVWII
VGTLLPASAGQDPPQTLTPTVACRHRRGRSQCCPSPRLRMVETLSNLLRSVVALSPPDLA
PVLYLSLSRLGPPQQGLELGVGDGVLLKAVAQATGKQAWGVVAVLVGSGVTASVXPRAAS
PEEVWPPPFAPGTDCSTPLQSTAKKIDVIKGLFVACRHSEARYIARALSGRLRLGLAEQS
VLAALAQAVSLTPPGQGFPPAVVDAGKGRTAEARKTWLEEQAMILKQTFCEVPDLDRIIP
VLLEHGLERLPEHCKLSPGVPLKPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQVRG
WAHAFSRREEDNIYPYPWISLFTFQIKLPSVTSFILDTEAVAWDREKQQIQPFQVLTTRK
RKEVDAAEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFAASLDTK
DTDQIAEFLEQSVKDSCEGLMVKTLDVNATYEIAKRSHNWLKLKKDYLDGVGDTLDVLSL
SVALWLVSSLHSPSSLPRLLCLRHPCVAVYLRPPFSFRPPQSLALTLRPETLSSSHRCCF
LQALVLPTPRPYVRADGAVAPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDGEKGISLR
FPRFIRVREDKKPEEATTSAQVASLYRKQSQIQNQQGADLDSDSEDFY
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtagtatcatgtcatttttctaccccaagaaggagggcaaagtgaaaaaacca
gagaaggagacctccaacagcgtcagagagaccgaaccacctccaaaggtagcactgaag
gagcggaatggagaggtgcctgagaacgattctccagtgaagaggccagggcgcaaagtg
gcccgggtcctgagcagtgaaggggaggaggaagatgaagccctcacgccctccaaaggc
cagaagcctgccccgggctctccacaagtctcccctcccagccctgccacatttcccgag
agcagcccttccctctccaacacctctcctgtggacatctccccatcagggatccccaag
cggcgcacagctcggaagcagcttcctaagaggacaatacaggatgtcctggaggagcag
ggcaaggaagaggacagagaggccaagaggaagaaggaggaagaagctgagacctcaccg
gagagcctcacagagcctgaagtgacccagaagaaagaagcagaaggggaccggcccatg
acgccccctgagacctccccagcagagcccccgccagacggcgcctcggagcctgaggtg
gccgagaagcagcaggctcgggaggaggacccagccaagccgcccgccagagctcccaag
ccggtcagcagcttcttcgccccccggaaaccgtgtgagaaggtccgggtctggattata
gtgggaaccctgctcccagcgagcgcaggccaggacccaccccagaccctgacccctacc
gtggcgtgtcgtcaccgcagggggaggtcacagtgttgcccctcccccaggctccggatg
gtggagacgctgagcaacttgctgcgttctgtggtggccctgtcgcctcccgacctcgcc
ccggtcctctacctcagcctcagccgccttgggccgccccagcagggcctggagcttggc
gtcggtgacggcgtcctgctcaaggctgtggcccaggccacgggtaagcaagcgtggggt
gtggtggcagttctagttgggagtggggtgacagcaagtgtgtaaccccgggcggccagc
ccggaggaggtgtggccccctcccttcgccccaggcactgactgctccaccccgcttcag
tccacagccaagaagatagacgtcatcaaaggcctctttgtcgcctgccgccactcggaa
gcccgatacatcgccagagccctgagtggacggctgcgcctcgggctggcagagcagtcg
gtgctggccgcccttgcccaggccgtgagcctcacgcccccaggccaaggattccccccg
gccgtcgtggatgctgggaagggcaggacagcagaggcccgaaagacgtggctggaggag
caagccatgatcctgaagcagacattctgcgaggtgccggacctggaccggatcatcccc
gtgctgctggagcacggcctggagcgcctcccggagcactgcaagctgagcccaggggtt
cccctgaaaccgatgctggcgcaccccacgcggggtgtcagtgaggtcctgaaacgcttc
gaggaggcagctttcacctgcgagtacaaatacgacgggcagagggcgcaggtacggggg
tgggcacacgccttcagcagaagggaggaagataatatttatccatacccctggatctct
ctcttcacctttcagattaaactcccgtcagtcacgtccttcatcctagacacagaagct
gtggcttgggaccgggaaaagcagcagatccagccattccaggtgctcaccacccgcaaa
cgcaaggaggtggacgcggcagagatccaggtgcaggtgtgtctgtatgccttcgacctc
atctacctcaatggagagtccctggtgcgtgagccgctttcccgacgccggcagctgctc
cgggagaatttcgtggagacggagggcgagtttgtctttgccgcctccctggacaccaag
gacacagaccagatcgccgagttcttggagcagtctgtgaaagactcctgcgaggggctc
atggtgaaaaccctggacgtcaacgccacctacgagatcgccaagagatcgcacaactgg
ctcaagctgaagaaggattacctcgatggtgtgggcgacaccctggacgttctgtctctc
tctgtggctctctggctcgtttcttcccttcattccccctcatccctgcccaggctctta
tgtttaaggcatccctgtgtcgccgtctatctccgtcccccattttcctttcgacccccc
caatccctagctttgactttgagacccgagaccctctcctcctcacaccgctgctgtttt
ctgcaggccctggtgctgcccaccccacgcccctacgtccgggcagacggggctgtggcc
cccgaccactggctggaccccagcgccgtatgggaggtgaaatgtgccgatctgtccctg
tcccccatctaccctgctgcccgcggcctggttgatggtgagaaggggatctcccttcgc
ttccctcggtttatccgtgtccgtgaagacaagaagccggaggaggccaccaccagtgcc
caggtggcctcactgtacaggaagcagagtcagattcaaaaccagcagggcgcagacttg
gactccgactcggaagatttctactag

DBGET integrated database retrieval system