KEGG   Ursus maritimus (polar bear): 103657263
Entry
103657263         CDS       T03271                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04916  Melanogenesis
umr04934  Cushing syndrome
umr05132  Salmonella infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103657263 (TCF7L2)
   04390 Hippo signaling pathway
    103657263 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103657263 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103657263 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103657263 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103657263 (TCF7L2)
   05225 Hepatocellular carcinoma
    103657263 (TCF7L2)
   05226 Gastric cancer
    103657263 (TCF7L2)
   05216 Thyroid cancer
    103657263 (TCF7L2)
   05221 Acute myeloid leukemia
    103657263 (TCF7L2)
   05217 Basal cell carcinoma
    103657263 (TCF7L2)
   05215 Prostate cancer
    103657263 (TCF7L2)
   05213 Endometrial cancer
    103657263 (TCF7L2)
   05224 Breast cancer
    103657263 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103657263 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103657263 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103657263 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103657263 (TCF7L2)
   05165 Human papillomavirus infection
    103657263 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103657263 (TCF7L2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103657263 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103657263
NCBI-ProteinID: XP_008682912
UniProt: A0A384BK04
LinkDB
Position
Un
AA seq 521 aa
MKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVF
RDMKRSHSLHKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVD
PKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALT
VNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSK
KEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSA
PKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSP
PQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHGKAPALCPNGALDLPPAA
LQPPIMSSSSLAQPSTSSLHSHSALAGTQPQPLSLVTKSLE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgatgtccaggcggggaccctccagagcagacaagccctcaag
gatgcccgctctccgtcgccggcacacattgtccagtgccccctcccttgctgcactcag
ggacatgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttc
agggacatgaaaaggagccactccttacacaaggttggggagccctggtgtttggagtcg
aacaaagtgccagtcgtgcagcaccctcaccatgttcaccctctcacgccgctcatcacg
tacagcaatgagcacttcaccccgggaaacccacctccacacttaccagctgacgtagac
cccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattacccgcta
tcgcccggcaccgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggt
cagccagtgtacccaatcacgacaggaggattccgtcacccctaccccacagctctgacc
gtcaacgcttccatgtccagcttcctgtcttccaggttccctccccatatggttccacca
catcacactctacatacgaccggcatcccccacccggccatagtcacgccaacagtcaaa
caggaatcctcccagagtgacgtcggctcactccatagctcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccgcacataaagaaacctcttaacgcgttcatgttgtat
atgaaggagatgagggcgaaggtcgtggccgagtgcacgttgaaagaaagcgcggccatc
aaccagatcctggggcgaaggtggcacgcactgtccagagaagagcaagcgaagtactac
gagctggcccggaaggagcgacagcttcacatgcagctgtaccccggctggtctgcgcgg
gataactacgggaagaagaagaagaggaaaagggacaagcagcccggagagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccc
tcttcagatggaagcttactagactcgcctcctccctcccccaacctgctaggctcccct
ccccaagacgccaagtcacagactgagcagacccagcctctctcgctgtccctgaagccc
gaccccctggcccacctgtccatgatgcctccgccgcccgccctcctgcttgccgaggcc
gcccacggcaaggcccccgccctctgtcccaacggggccctggacctgcctcccgccgct
ttgcagccgcccatcatgtcctcctcctctcttgcacagccgtcaacatcttccttacat
tcccacagcgctctggccgggacgcagccccagccgctgtccctcgtgaccaagtcttta
gaatag

KEGG   Ursus maritimus (polar bear): 103661728
Entry
103661728         CDS       T03271                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04916  Melanogenesis
umr04934  Cushing syndrome
umr05132  Salmonella infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103661728 (LEF1)
   04390 Hippo signaling pathway
    103661728 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103661728 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103661728 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661728 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103661728 (LEF1)
   05225 Hepatocellular carcinoma
    103661728 (LEF1)
   05226 Gastric cancer
    103661728 (LEF1)
   05216 Thyroid cancer
    103661728 (LEF1)
   05221 Acute myeloid leukemia
    103661728 (LEF1)
   05217 Basal cell carcinoma
    103661728 (LEF1)
   05215 Prostate cancer
    103661728 (LEF1)
   05213 Endometrial cancer
    103661728 (LEF1)
   05224 Breast cancer
    103661728 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103661728 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103661728 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103661728 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103661728 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103661728 (LEF1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103661728 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103661728
NCBI-ProteinID: XP_008687630
UniProt: A0A384BZP2
LinkDB
Position
Un
AA seq 413 aa
MPQLSGAGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNES
EIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
NDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVNSK
QGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSR
FSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKK
PLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQ
LYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcgggggagacccggaactctgcgccaccgac
gagatgatccccttcaaagatgagggcgatcctcagaaggagaaaatcttcgcagaaatc
agtcaccctgaagaggaaggcgacttagccgacatcaagtcttcattggttaacgagtct
gaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctcccaggag
tcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatggaggcctc
tacaataagggaccctcctactcgagttattccgggtacataatgatgccaaatatgaat
aatgacccatacatgtcaaatggatctctttctccacccatcccaagaacatcaaataag
gtgcccgtggtgcagccatcgcatgcagtccatcctctcacccccctcatcacgtacagc
gacgagcacttttctccaggatcacatccctcacacctcccatcagatgtcaactccaaa
caaggcatgtccagacatcctccagctcctgagatccccaccttttatcccctgtctccg
ggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtctatcccatc
acgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtccagg
ttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccctcatcca
gctatcgtaacgcctcaggtcaaacaggagcacccccacactgacagtgacctaatgcac
gtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacattaagaag
cctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagctgagtgt
actttaaaagaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctctcc
cgtgaagagcaggcgaaatactatgaattagcccggaaggaaagacagctgcatatgcag
ctctatccaggctggtccgcgagagacaattacgggaagaagaagaagaggaagagagag
aaactccaggaatcgacatcaggtggaaaacgaagctccttcccaacgtgcaaagccaag
gcagcgaccccgggacctctgctggagatggaagcttgttga

KEGG   Ursus maritimus (polar bear): 103663815
Entry
103663815         CDS       T03271                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04916  Melanogenesis
umr04934  Cushing syndrome
umr05132  Salmonella infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103663815 (TCF7)
   04390 Hippo signaling pathway
    103663815 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103663815 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    103663815 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103663815 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663815 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103663815 (TCF7)
   05225 Hepatocellular carcinoma
    103663815 (TCF7)
   05226 Gastric cancer
    103663815 (TCF7)
   05216 Thyroid cancer
    103663815 (TCF7)
   05221 Acute myeloid leukemia
    103663815 (TCF7)
   05217 Basal cell carcinoma
    103663815 (TCF7)
   05215 Prostate cancer
    103663815 (TCF7)
   05213 Endometrial cancer
    103663815 (TCF7)
   05224 Breast cancer
    103663815 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103663815 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103663815 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103663815 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103663815 (TCF7)
   05165 Human papillomavirus infection
    103663815 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103663815 (TCF7)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103663815 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103663815
NCBI-ProteinID: XP_008689830
UniProt: A0A384C617
LinkDB
Position
Un
AA seq 296 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPA
PTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKVE
KEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYEL
ARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESSTVSSSLNSALPLLHDPGAQS
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccgcccccgtcg
ggagcagggcagcacccccagccgcagcccccgctgcacaacaaggccagtcagccagcc
catagcgtcccacaactctctcctctctatgaacatttcagcagcccacaccctacacct
gcaccagccgacatcagccagaaacaaggagttcacaggccactgcagacccctgacctc
tctggcttctactctctgacctcaggcagcatgggacaactcccccacactgtgagctgg
cccagccctcctctctaccccttgtccccttcctgcggatatagacagcacttccctgcc
cccactgcagcccctggcgccccctaccccaggttcacccacccatccctgatgctaggc
tctggtgtacctggtcaccctgcagccatcccccacccagccatcgtacctccctcaggg
aagcaggagctgcagccgtatgaccgtagcctgaagacgcaggcagaatccaaggtagag
aaggaggccaagaagccaaccatcaagaagcccctcaacgccttcatgctgtacatgaag
gagatgagagccaaggtcatagcagagtgcacgctcaaggagagtgctgccatcaaccag
atcctgggccgaaggtggcatgcgctgtctcgggaagagcaagccaagtattatgagctg
gcccgaaaggagaggcagctgcatatgcaactgtacccaggctggtcggcgcgggacaat
tatgggaagaagaaaaggcgatcacgggaaaagcaccaggaatccagcacagttagttcc
agtctaaactcagcactaccattacttcatgatcctggggcgcagtcctaa

KEGG   Ursus maritimus (polar bear): 103671448
Entry
103671448         CDS       T03271                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04916  Melanogenesis
umr04934  Cushing syndrome
umr05132  Salmonella infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103671448 (TCF7L1)
   04390 Hippo signaling pathway
    103671448 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103671448 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103671448 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671448 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671448 (TCF7L1)
   05225 Hepatocellular carcinoma
    103671448 (TCF7L1)
   05226 Gastric cancer
    103671448 (TCF7L1)
   05216 Thyroid cancer
    103671448 (TCF7L1)
   05221 Acute myeloid leukemia
    103671448 (TCF7L1)
   05217 Basal cell carcinoma
    103671448 (TCF7L1)
   05215 Prostate cancer
    103671448 (TCF7L1)
   05213 Endometrial cancer
    103671448 (TCF7L1)
   05224 Breast cancer
    103671448 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103671448 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103671448 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103671448 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103671448 (TCF7L1)
   05165 Human papillomavirus infection
    103671448 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103671448 (TCF7L1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103671448 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 103671448
NCBI-ProteinID: XP_008698284
UniProt: A0A384CUW7
LinkDB
Position
Un
AA seq 444 aa
GTEYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQPPHHMHPLTPLITYSNDHFSP
GSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPP
GGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPASGIPHPAIVSPIVKQEPAPPSL
SPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKW
HNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAE
GALASKSKKPCVQYLPPEKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLS
LTTKPESRAQLALHSAAFLSAKATATTSGQMGSQPPLLSRPLPLGSLPTALLTSPPSFPA
ALHAHQALPVLQAQPLSLVTKSAH
NT seq 1335 nt   +upstreamnt  +downstreamnt
ggcacggagtacctgcagatgaaatggcccctcctcgatgtcccctccagcgccacagtc
aaggacaccaggtcaccgtccccagcacacttgtctaataaagttcctgttgttcagccc
ccgcatcacatgcacccgttgacgcccctcatcacctacagcaacgaccacttctcccct
ggctcccctcccacgcacctctccccagagatcgatccaaagacaggaatcccccggccc
cctcacccatctgagctgtctccgtattacccactgtctcctggagctgtcggacaaatc
ccccatcccctcggctggctcgtcccacagcaaggacagcccatgtactccctccctcct
ggtggtttccggcacccctaccctgccctcgccatgaacgcctcaatgtccagcctggtt
tccagtcggttctctcctcacatggtggctccggcccatcctggtctgcccgcctcaggg
attccccaccccgccatcgtctcccccatcgtcaagcaggagccagcgccccccagcctc
agcccggccgtgagcgcgaaatcaccagtcacggtgaaaaaggaggaagaaaagaaaccc
cacgtgaagaagcctctgaatgccttcatgttgtatatgaaagagatgagggccaaggtg
gtggccgagtgcaccctgaaggagagcgcggccattaaccaaatcctggggagaaagtgg
cacaacctgtcccgagaagaacaggccaagtactatgagctggcccggaaggagcggcag
cttcactcccagctctacccgacctggtcagcccgcgacaactacggtaagaaaaagaag
aggaagagagaaaagcagctgtcacagacacagtcccagcagcaagtccaagaggctgag
ggcgctctggcctccaaaagcaagaagccatgtgttcagtacctgccccctgagaagtcc
tgtgacagccctgcctcttcccacggcagcatgctggactccccggccaccccctccgca
gccttggcgtccccggctgcccctgcggcgacccactcggagcaagcccagcccctctcc
ctcaccaccaagccggagagccgggcccagctggctttacactctgctgccttcctgtcc
gccaaggcgacagccaccacctctggccagatgggcagccagcccccgctcctctcccgg
ccgctccccctcgggtccctgcccacagctctgctgacttctcccccctccttcccggcc
gcgctccatgcccaccaggccctcccagtcctccaggcccagcctctttccttggtcacc
aagtctgcccactga

DBGET integrated database retrieval system