KEGG   Ursus maritimus (polar bear): 103657308
Entry
103657308         CDS       T03271                                 

Definition
(RefSeq) beta-1,4-galactosyltransferase 3-like
  KO
K07968  beta-1,4-galactosyltransferase 3 [EC:2.4.1.90 2.4.1.38 2.4.1.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00510  N-Glycan biosynthesis
umr00513  Various types of N-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr00533  Glycosaminoglycan biosynthesis - keratan sulfate
umr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
umr01100  Metabolic pathways
Module
umr_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103657308
   00513 Various types of N-glycan biosynthesis
    103657308
   00515 Mannose type O-glycan biosynthesis
    103657308
   00514 Other types of O-glycan biosynthesis
    103657308
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103657308
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103657308
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103657308
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     103657308
    2.4.1.90  N-acetyllactosamine synthase
     103657308
    2.4.1.-  
     103657308
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   103657308
  Glycolipid
   103657308
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Other DBs
NCBI-GeneID: 103657308
NCBI-ProteinID: XP_008682962
UniProt: A0A384BK55
LinkDB
Position
Un
AA seq 356 aa
MEQQRGLLLLFLGVQLLLMGAFLYQNHHRHSLASFLRVLIQDRPTVGEELPFLVSVSSAE
TSSQDVYANLSQIHPVDISEEHLPSCPLISPYINGPVKVMIPENLTMEQVVEKNPLVELG
GQYRPPDCWTRHHTAVVVPYYGQNQHLRHLLFHLHPFLQRQQLHYAIYVVNQVHNTAFNR
GKLRNVGFWEAMQEEEWDCVFFHDVNLLPEDDRNLYICDIFPAHVSVAIDKFNYKLPYHG
YLGGVFALRPIHYLRINGFPNTYWGWDHEDHDIAARLQLSGLLLSRPHLLFGRYHMLEGQ
EPSPPQSPWSSFLLAPIRHKWQQDGINSLGYRLLSKERQPLYTNLTVDINFPTSQP
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaacagcagagggggctcctgttactatttctgggggtacagctgctgcttatgggg
gcattcctctaccagaaccaccaccgccacagcctcgcctccttcttacgcgtcctgata
caggacaggccaacggtgggagaagagttgccctttttggtctcggtctcctctgcagag
acctcttcccaggacgtgtacgccaacctcagccagatccaccctgtggacattagtgag
gagcacctgcccagctgccccctcatctcaccctacatcaatggccccgtgaaggtgatg
atcccggagaacctgacgatggagcaggtggtggaaaagaacccgctggtggagctggga
ggccagtaccggccacctgactgctggacacggcaccacacggcagtcgtggtgccctac
tatgggcagaaccagcacctgcggcacctgctcttccacctgcaccccttcctgcagcgc
cagcaactgcactatgccatctacgtggtgaaccaggtgcacaacaccgccttcaaccgg
ggcaagctacgcaacgtggggttctgggaggccatgcaggaggaggaatgggactgtgtc
ttcttccacgatgtgaacctccttccagaggacgaccgcaacctctacatctgtgacatc
ttccctgcccatgtgtctgtggccattgacaagttcaactacaagctaccctaccacggc
taccttgggggggtgtttgccctgcgccccattcactacctgaggataaatggcttcccc
aacacatactggggctgggatcatgaggaccacgacatcgctgccaggctgcaactgagt
gggctgcttctctcccgaccccatctgctctttggccgctaccacatgctggaggggcag
gagcccagccccccgcagagcccctggagctctttccttctggccccgatccgccacaaa
tggcagcaggatggcataaactcgctgggctacaggctgctctccaaggaacggcagccc
ctctacaccaacctcaccgtggacatcaacttcccaacttcgcagccctag

KEGG   Ursus maritimus (polar bear): 103667105
Entry
103667105         CDS       T03271                                 

Gene name
B4GALT1
Definition
(RefSeq) beta-1,4-galactosyltransferase 1
  KO
K07966  beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00052  Galactose metabolism
umr00510  N-Glycan biosynthesis
umr00513  Various types of N-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr00533  Glycosaminoglycan biosynthesis - keratan sulfate
umr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
umr01100  Metabolic pathways
Module
umr_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103667105 (B4GALT1)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103667105 (B4GALT1)
   00513 Various types of N-glycan biosynthesis
    103667105 (B4GALT1)
   00515 Mannose type O-glycan biosynthesis
    103667105 (B4GALT1)
   00514 Other types of O-glycan biosynthesis
    103667105 (B4GALT1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103667105 (B4GALT1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103667105 (B4GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103667105 (B4GALT1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103667105 (B4GALT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103667105 (B4GALT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     103667105 (B4GALT1)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     103667105 (B4GALT1)
    2.4.1.90  N-acetyllactosamine synthase
     103667105 (B4GALT1)
    2.4.1.-  
     103667105 (B4GALT1)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   103667105 (B4GALT1)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    103667105 (B4GALT1)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103667105 (B4GALT1)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 103667105
NCBI-ProteinID: XP_008693432
UniProt: A0A384CF77
LinkDB
Position
Un
AA seq 325 aa
ELRPRGAPPPPPLDASSELRSGRDSSPDTHSHPGSGSASNLTSAPVPSTTALSLLACPEE
SPLLVGPMVIEFNMPVDLKLVEKQNPEVKVGGRYTPKNCISPHKVAIIIPFRNRQEHLKY
WLYYLHPILQRQQLDYGIYVVNQAGETMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIP
MNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGE
DDDIFNRLVFKGMSVSRPNAVVGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNT
LTYKVLDIERNPLYTKITVDIGTPS
NT seq 978 nt   +upstreamnt  +downstreamnt
gagctccgacctcgaggggccccgcctccgccgcctttggacgcttcctccgagctgcgc
tcgggtcgcgactccagcccagacacgcactctcaccccggctccggttccgccagcaac
ttgacttcggccccagtgccctccaccacagcgctgtcgctgctcgcatgccctgaggag
tccccactgctcgtcggccccatggtgatcgagtttaacatgcctgtggacctgaagctt
gtggagaaacagaacccagaggtgaaggtgggcggccgctatacccccaagaactgcatc
tctccccacaaggtggccatcattattccattccgtaaccggcaggaacacctcaagtac
tggctgtattacttgcacccaatcctacagcgtcagcagttagactacggcatctatgtt
gtcaaccaggctggagaaaccatgttcaatcgtgctaagctcctcaacattggctttcaa
gaggccttgaaggactatgactacaactgctttgtgtttagcgatgtggacctcattcca
atgaacgaccataacgcctacaggtgtttttcacagccacggcacatttcggtggccatg
gataagtttggatttagcctaccttatgttcagtattttggaggtgtctctgctctaagt
aaacaacagtttctcaccatcaatggatttcctaataactactggggctggggaggtgaa
gatgatgacatttttaacagattagtttttaaaggtatgtctgtatctcgcccaaatgct
gtggttggcaagtgtcggatgatccgccactcaagagacaagaaaaatgaacccaatcct
cagaggtttgatcgaattgcacatacaaaggagaccatgctgtcggacggtctgaacaca
ctcacttacaaggtgttggacatagagagaaacccgttgtataccaaaatcacagtggac
atcgggacaccgagctag

KEGG   Ursus maritimus (polar bear): 103670800
Entry
103670800         CDS       T03271                                 

Gene name
B4GALT2
Definition
(RefSeq) beta-1,4-galactosyltransferase 2
  KO
K07967  beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00052  Galactose metabolism
umr00510  N-Glycan biosynthesis
umr00513  Various types of N-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr00533  Glycosaminoglycan biosynthesis - keratan sulfate
umr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
umr01100  Metabolic pathways
Module
umr_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103670800 (B4GALT2)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103670800 (B4GALT2)
   00513 Various types of N-glycan biosynthesis
    103670800 (B4GALT2)
   00515 Mannose type O-glycan biosynthesis
    103670800 (B4GALT2)
   00514 Other types of O-glycan biosynthesis
    103670800 (B4GALT2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103670800 (B4GALT2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103670800 (B4GALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670800 (B4GALT2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     103670800 (B4GALT2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     103670800 (B4GALT2)
    2.4.1.90  N-acetyllactosamine synthase
     103670800 (B4GALT2)
    2.4.1.-  
     103670800 (B4GALT2)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   103670800 (B4GALT2)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 103670800
NCBI-ProteinID: XP_008697537
UniProt: A0A384CRS7
LinkDB
Position
Un
AA seq 398 aa
MAVYVEEQRLCLPAAGCPGPLGGPAAACGMSRLLGGTLERVCKAVLLLCLLHFLVAVILY
FDVYAQHLAFFSRFSARGPARALHPAASSSTNFSRPNATVPSSGLPEAPSARPGPTAPIL
PPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLLGGRYTPPDCAPAQTVAVIIPFRHR
EHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDATYDCFIF
SDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNE
YWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTM
KRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggctgtgtacgtcgaggagcaacggctttgtttgccggcagccggatgcccgggccca
ttgggcgggccggcggccgcctgcgggatgagcagactgctgggggggacgctggagcgc
gtgtgcaaggctgtgctccttctctgcctgctgcacttcctcgtggccgtcatcctctac
tttgacgtctacgcccagcatttggccttcttcagccgcttcagtgcccgcggccctgcc
cgtgccctccacccagctgccagcagcagcaccaacttctctcggcccaacgccaccgtc
cccagctcggggctccccgaggctcccagtgcccggcccggccccacggctcccatcttg
cctccctgtcctgactcgccgcctggtctcgtgggccgactgctgatcgagttcacctcg
cccatgccgctggagcgggtgcagcgggagaacccaggtgtgctgctgggcggccgctat
acgccgcccgactgcgcgcctgcccagacggtggcggtcatcatcccctttcgacaccgg
gagcaccacctacgctactggctccactacctgcaccccatcctgaggcgacagcggctg
cgctatggcgtctacgtcatcaaccagcacggtgaagacaccttcaaccgggccaagctg
ctcaacgtgggcttcctagaggcgctgaaggaggatgccacctacgactgcttcatcttc
agtgacgtggacctggtccccatggatgaccgcaacctgtaccgctgtggtgaccagccc
cgccactttgccattgccatggacaagttcggtttccggctgccctatgctggctacttt
ggaggcgtgtcaggcctgagtaaagcccagttcctgagaatcaacggcttccccaacgag
tactggggctggggtggtgaggatgacgacatcttcaaccggatctccctgactgggatg
aagatctcgcgcccagacatccgcataggccgctaccgcatgatcaagcacgaccgggac
aagcataacgagcccaacccgcagaggtttaccaagattcagaacacgaagctgaccatg
aagcgggatggcatcgggtcggtgcggtaccaggtcttggaagtgtctcggcaaccactc
ttcaccaatatcacagtggacattgggcggcccccgtcatggccccctcggggctga

KEGG   Ursus maritimus (polar bear): 103672017
Entry
103672017         CDS       T03271                                 

Gene name
B4GALT3
Definition
(RefSeq) beta-1,4-galactosyltransferase 3
  KO
K07968  beta-1,4-galactosyltransferase 3 [EC:2.4.1.90 2.4.1.38 2.4.1.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00510  N-Glycan biosynthesis
umr00513  Various types of N-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr00533  Glycosaminoglycan biosynthesis - keratan sulfate
umr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
umr01100  Metabolic pathways
Module
umr_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103672017 (B4GALT3)
   00513 Various types of N-glycan biosynthesis
    103672017 (B4GALT3)
   00515 Mannose type O-glycan biosynthesis
    103672017 (B4GALT3)
   00514 Other types of O-glycan biosynthesis
    103672017 (B4GALT3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103672017 (B4GALT3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103672017 (B4GALT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103672017 (B4GALT3)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     103672017 (B4GALT3)
    2.4.1.90  N-acetyllactosamine synthase
     103672017 (B4GALT3)
    2.4.1.-  
     103672017 (B4GALT3)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   103672017 (B4GALT3)
  Glycolipid
   103672017 (B4GALT3)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Other DBs
NCBI-GeneID: 103672017
NCBI-ProteinID: XP_008698878
UniProt: A0A384CVT1
LinkDB
Position
Un
AA seq 396 aa
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGREQGPTFDYSHPHDVYSNLSH
LPGAPVAPGAPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPA
GCEARSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNV
GVREALRDEEWNCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGV
SALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGN
EENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGPLYTNITADIGTDPRGPRTPSGPRY
PPGSSQAFRQEMLQRRPPARPGPLPTANHTAPHGSH
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttgcggaggctgctggagcggccctgcacactggccctgcttgtgggctcccagctg
gctgtcatgatgtacctgtcactggggggcttccgaagcctcagtgccctatttggccga
gagcaggggccgacatttgactattctcatccccatgatgtctacagtaacctcagtcac
ctacctggggcccctgttgccccaggggcccctccagctcctcaaggtctgccctactgt
ccagaacgatctcctcttttagtgggtcccgtgtccgtgtcctttagcccagtgccgtca
ctggcagagattgtggagaggaatccccgggtggaaccggggggccggtaccggcccgcg
gggtgtgaggcccgctcccgaacagccatcattgtgccccaccgggcccgggagcaccac
ctgcgcctgctgctgtaccacctgcaccccttcctgcagcgccagcagctggcttacggc
atctacgtcatccaccaggctggaaatggaacatttaacagggccaagctgctaaatgtt
ggggtgcgggaggccctgcgtgatgaggagtggaactgcctattcttgcacgacgtggac
ctcctgcctgagaacgaccacaatttgtatgtgtgtgacccccggggaccccggcatgtt
gctgttgccatgaacaagtttggatacagcctcccgtacccccagtactttggaggagtc
tcggcgctcactcctgaccagtacctgaagatgaatggcttccccaatgaatactggggc
tggggtggtgaggatgacgacattgctaccagggtgcggctggctgggatgaagatctct
cgcccccccacgtcggtggggcactacaagatggtgaagcatcgaggagataagggcaat
gaggaaaacccccacagatttgacctcctggtccgtacccagaattcctggacgcaagat
gggatgaactcactgacgtaccggttgctggctcgagagctgggccctctctataccaac
atcacagcagacattggaactgaccctcggggtccccggactccctctggtccccgttac
cctcctggttcctcccaggccttccgtcaagagatgctgcagcgccggcccccagccagg
cctggccctctgcctactgccaaccacacagccccccatggttcacactga

DBGET integrated database retrieval system