KEGG   Ursus maritimus (polar bear): 103657779Help
Entry
103657779         CDS       T03271                                 

Gene name
RNPEP
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:umr01002]
    103657779 (RNPEP)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     103657779 (RNPEP)
Peptidases and inhibitors [BR:umr01002]
 Metallo peptidases
  Family M1
   103657779 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 103657779
NCBI-ProteinID: XP_008683412
UniProt: A0A384BLH3
LinkDB All DBs
Position
Un
AA seq 551 aa AA seqDB search
MPQFENYYDWGTKRQQRKVRHSHYCTIAVGRVRTNAEHIIPPYLFVQGPEVCWLAPEQTA
GKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSANTWEKRGPNKFF
FQMCHPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIEAAKEEYNGVIEEFLATGEKLFG
PYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLVGDRSLADVIIHEISHSWFGNLVTNA
NWGEFWLNEGFTMYAQRRISTVLFGSAYTCLEAATGRALLRQHMNITGEDNPLNKLRVKI
EPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDNFLKAYVNEFKFQSILAEDFLEFY
LEYFPELKKRRVESIPGFEFDRWLNTPGWPPYLPDLSPGDSLMKPAEELAHLWVTEELDM
KAIEAVAISAWKTYQLVYFLDKILQQSPLPPGNVKKLGETYPKISNSQNAELRLRWGQIV
LKNDHQEDFWKVKDFLQSQGKQKYTLPLYHAMMAGSKVAQTLAKETFAATAPQLHSNVVN
YVQQIVTPKDS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatttgagaactactatgattggggaacgaaacgtcagcagagaaaggtgcgc
cactcgcactactgtaccatcgcagtaggacgagtgcggacaaatgcggagcacattatc
ccgccgtacctttttgtccaaggccctgaggtttgctggttggctcctgagcagacagca
ggaaagaagaagccttttgtctatacccagggtcaggctgtcctgaaccgggccttcttc
ccttgcttcgacactcctgcagtgaaatacaaatattcagctcttatcgaggtcccagat
ggcttcacagctgtgatgagtgctaacacctgggagaagagaggtccaaataagttcttc
ttccagatgtgtcatcccatcccctcctatctgatagctctggccatcggcgatctggtt
tcggctgaagttggacccaggagccgggtgtgggccgagccctgcctgatcgaggctgcc
aaggaggagtacaatggggtgatagaagaatttctggccacaggagagaaactttttgga
ccctacgtttggggaaggtatgacctgctcttcatgccgccatcctttccatttggagga
atggagaacccttgtctgacctttgtcaccccctgcctgctggttggggaccgctccttg
gccgacgtcatcatccatgagatctcccacagttggttcgggaacctggtcactaatgcc
aactggggtgaattctggctcaatgaaggtttcaccatgtatgcccagaggaggatctcc
accgtcctctttggttctgcttacacctgcttggaagctgcaaccggccgggctctgctt
cggcagcacatgaacatcaccggagaggacaacccactcaacaagctccgcgtgaagatc
gaaccaggtgtcgacccagatgatacctacaacgagaccccctacgagaaaggcttctgc
tttgtctcctacctggcccacttggtgggtgatcaggatcagtttgacaattttctcaag
gcctatgttaatgaattcaaattccaaagtatcttagctgaggactttctagagttctac
ttggaatacttccctgagctgaagaaaaggagagtggagtccattccaggttttgagttt
gatcggtggttgaataccccgggctggcccccctacctccctgacctctcccctggggac
tcacttatgaagcctgctgaagagctggcccacctgtgggtgaccgaggagctggacatg
aaggccatcgaagctgtggccatttctgcctggaagacctaccagctggtctatttcctc
gataagatcctccagcaatcccctctccctcccgggaatgtgaaaaaactcggagagaca
tacccaaagatctcaaactcccagaatgcggagctccggctacgatggggccagatcgtc
cttaagaatgaccatcaagaggatttctggaaagtgaaggatttcctgcagagccagggg
aagcagaagtatactcttccgctgtaccacgcgatgatggctggcagcaaggtggcccag
acccttgccaaggagaccttcgcggccaccgccccccagctccacagcaatgttgtcaac
tacgtccagcagatcgtgacgcccaaggacagttag

DBGET integrated database retrieval system