KEGG   Ursus maritimus (polar bear): 103657965Help
Entry
103657965         CDS       T03271                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00480  Glutathione metabolism
umr00980  Metabolism of xenobiotics by cytochrome P450
umr00982  Drug metabolism - cytochrome P450
umr00983  Drug metabolism - other enzymes
umr01524  Platinum drug resistance
umr05200  Pathways in cancer
umr05204  Chemical carcinogenesis
umr05225  Hepatocellular carcinoma
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103657965 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103657965 (MGST2)
   00982 Drug metabolism - cytochrome P450
    103657965 (MGST2)
   00983 Drug metabolism - other enzymes
    103657965 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103657965 (MGST2)
   05204 Chemical carcinogenesis
    103657965 (MGST2)
   05225 Hepatocellular carcinoma
    103657965 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103657965 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    103657965 (MGST2)
Enzymes [BR:umr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103657965 (MGST2)
Transporters [BR:umr02000]
 Other Transporters
  Pores ion channels [TC:1]
   103657965 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 103657965
NCBI-ProteinID: XP_008683636
LinkDB All DBs
Position
Un
AA seq 174 aa AA seqDB search
MAGHSILLAAVSVLSACQQSYFALHVGKARLKYKVTPPAVSGSPEFERIFRAQNLPNSRA
VQKSVRSEFSQGTRPCCGCTRQNCVEFYPIFLITLWIAGWYFNQVFATCLGLLYIYARHQ
YFWGYSEAAKKRITGFRLSLGSLALLTVLGALGIANSFLDEYLDVNVAKKLRPF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcattcaatcttgctggctgctgtctccgtcctgtcggcgtgtcagcaaagt
tattttgctttgcacgtaggaaaagcaagattaaaatacaaagttacacccccggcagtc
tctgggtcaccagagtttgaaagaatatttcgtgcacaaaatctaccaaacagcagagct
gttcagaagagtgtgaggtcagagttctcccaagggacgcggccatgctgcgggtgcacg
agacaaaactgtgtggagttttaccccatatttctgattacattgtggatcgctggatgg
tatttcaatcaagtttttgctacctgtctgggtctgctgtacatatatgcccgtcaccag
tatttctggggatattcagaagcagctaaaaaaaggatcaccggtttccggctgagtctg
gggagtctggccttgctgacagtcctaggcgccctgggaattgcaaacagcttcctggac
gaatacctggacgtcaatgtcgccaagaaactgagacccttctaa

DBGET integrated database retrieval system