KEGG   Ursus maritimus (polar bear): 103658229
Entry
103658229         CDS       T03271                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03320  PPAR signaling pathway
umr04659  Th17 cell differentiation
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05216  Thyroid cancer
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103658229 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103658229 (RXRG)
   03320 PPAR signaling pathway
    103658229 (RXRG)
   04919 Thyroid hormone signaling pathway
    103658229 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    103658229 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658229 (RXRG)
   05202 Transcriptional misregulation in cancer
    103658229 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    103658229 (RXRG)
   05216 Thyroid cancer
    103658229 (RXRG)
   05222 Small cell lung cancer
    103658229 (RXRG)
   05223 Non-small cell lung cancer
    103658229 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103658229 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:umr03310]
    103658229 (RXRG)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103658229 (RXRG)
Nuclear receptors [BR:umr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103658229 (RXRG)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103658229
NCBI-ProteinID: XP_008683928
UniProt: A0A384BMX2
LinkDB
Position
Un
AA seq 292 aa
MNYPSTSPSSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERILEAE
LAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGR
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaactatccatcaaccagccccagttcgctggtgaaacacatctgtgccatctgtggg
gacaggtcctcaggaaagcactacggtgtatacagttgtgaaggctgcaaagggttcttc
aagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaggactgcctcatt
gacaagcgccagaggaaccgctgtcagtactgccgttaccagaagtgcctggtgatgggc
atgaagagggaagctgtgcaggaagaaaggcagaggagccgggagcgggccgagagcgag
gcagaatgcgccagtagcggccatgaagatatgcctgtggagcggattctagaagctgaa
cttgctgttgaaccaaagacagaatcctatggtgatatgaacatggagaactcgacgaat
gaccctgtcaccaacatatgccatgctgctgacaagcagcttttcactcttgttgaatgg
gccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcattctcctccgg
gcagggtggaatgagctgctgattgcctccttctcccaccgctccgtctccgtgcaggat
ggcattctcctggccacgggcttacacgtccaccggagcagtgcccacagtgccggggtc
ggctccatcttcgacagggtcctgactgagctggtctccaaaatgaaagacatgcagatg
gacaagtcggagctggggtgcctgcgagccatcgtgctgtttaacccagatgccaagggg
ctgtccaacccctcggaggtagagactctgcgagagaaggtttatgctacccttgaggcc
tacacgaagcagaagtatccggaacaacctggcaggtga

KEGG   Ursus maritimus (polar bear): 103665560
Entry
103665560         CDS       T03271                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03320  PPAR signaling pathway
umr04659  Th17 cell differentiation
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05216  Thyroid cancer
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103665560 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103665560 (RXRB)
   03320 PPAR signaling pathway
    103665560 (RXRB)
   04919 Thyroid hormone signaling pathway
    103665560 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    103665560 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665560 (RXRB)
   05202 Transcriptional misregulation in cancer
    103665560 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    103665560 (RXRB)
   05216 Thyroid cancer
    103665560 (RXRB)
   05222 Small cell lung cancer
    103665560 (RXRB)
   05223 Non-small cell lung cancer
    103665560 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103665560 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:umr03310]
    103665560 (RXRB)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103665560 (RXRB)
Nuclear receptors [BR:umr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103665560 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 103665560
NCBI-ProteinID: XP_008691731
UniProt: A0A384CA25
LinkDB
Position
Un
AA seq 500 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPDSRSPDSSSPNPLPQ
GAPPPSPPGLPLPPSAASSLGGSGAPPPPQMPPPPLGSPFPVISSSMGSPGLPPPAPPGF
SGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSS
GKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKRE
AVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPN
DPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRD
GILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKG
LSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcctcccggtggcggcggcgacgg
ccctggctggatcccgactcccgaagcccagacagttcctccccgaatccccttccccag
ggggcccctccgccttctcctcctgggctccccttaccaccttcagcagcctcatccctt
ggaggctccggggccccacccccaccccagatgccaccccccccactgggctccccattc
ccggtcatcagctcttccatggggtcccctggtctgccccctccagctcccccaggattc
tccgggcctgtcagcagtccccagattaactcaacagtgtcgctccctgggggtgggtct
ggcccccctgaagatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccc
cctccaggtggccctggggctggcaaacggctctgtgcaatctgcggggaccgaagctca
ggcaaacactatggggtttacagctgtgagggctgcaaaggcttcttcaagcgcaccatc
cgtaaggacctgacgtactcgtgccgggacaacaaggactgcactgtggacaagcgccag
cgaaaccgctgtcagtactgccgctatcagaagtgcctggccaccggcatgaagagggag
gcggtacaggaggagcgtcagcgggggaaggacaaggacggggatggggagggggctggg
ggagcccccgaggagatgcctgtggacaggatcctggaggcagagcttgctgtggagcag
aagagtgaccagggcgttgagggtcctgggggaaccgggggtagcggcagcagcccaaat
gaccccgtgactaacatctgtcaggcagctgacaaacaactattcacgcttgttgagtgg
gcgaagaggatccctcacttttcctccttgcctctggatgaccaggtcattttgctacgg
gcaggctggaatgagctcctcattgcttccttctcccaccgatccattgatgtccgagat
ggtatcctcctcgccacaggtcttcatgtgcaccgcaactcagcccattctgcaggcgtg
ggagccatctttgatcgggtgctgacagagctagtgtccaaaatgcgtgacatgaggatg
gacaagacagagcttggctgcctgagggcaatcattctgttcaatccagatgccaagggc
ctctccaaccctagtgaggtggaggttctgcgggagaaagtgtacgcatcactggagacc
tattgcaagcagaagtaccctgagcagcagggacggtttgccaagttgctgctacgtctt
cctgccctcaggtccatcggccttaagtgtctagagcatctgtttttcttcaagctcatt
ggagacacccccattgacaccttcctcatggagatgcttgaggctccccaccagctggcc
tga

KEGG   Ursus maritimus (polar bear): 103679944
Entry
103679944         CDS       T03271                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03320  PPAR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04659  Th17 cell differentiation
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04932  Non-alcoholic fatty liver disease
umr04976  Bile secretion
umr05160  Hepatitis C
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05216  Thyroid cancer
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103679944 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103679944 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103679944 (RXRA)
   03320 PPAR signaling pathway
    103679944 (RXRA)
   04919 Thyroid hormone signaling pathway
    103679944 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    103679944 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    103679944 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679944 (RXRA)
   05202 Transcriptional misregulation in cancer
    103679944 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    103679944 (RXRA)
   05216 Thyroid cancer
    103679944 (RXRA)
   05222 Small cell lung cancer
    103679944 (RXRA)
   05223 Non-small cell lung cancer
    103679944 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103679944 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103679944 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103679944 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:umr03310]
    103679944 (RXRA)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103679944 (RXRA)
Nuclear receptors [BR:umr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103679944 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103679944
NCBI-ProteinID: XP_008707690
UniProt: A0A384DLK7
LinkDB
Position
Un
AA seq 496 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTG
SPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVY
SCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRRPSPIRGPGAIALGKCREGLHPSAVRKV
LPQDIGSGKRALSVESHESAGRKLGRGPEALQLSESANLSWLPCGSVPWAGSASRRRHCV
LFMLCPCIPQQWAGYQAFSMVQLGVQSGTVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVDANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRR
GSHVPQRHAQTCSPQC
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggctgccccctccctgcacccctctctggggcccggcatcggctcctcgctcggctcc
ccgggacagctgcactcgcccatcaacggcatgggcccacccttctcggtcatcagctcc
cccatgggcccccactccatgtcagtgcccaccacgcctaccctgggcttcggcaccggc
agccctcagctcagctcacccatgaaccccgtcagcagcagcgaggacatcaagcccccg
ctgggcctcaatggtgtcctcaaagtcccggcccacccctcagggaacatggcgtccttc
accaagcacatctgtgccatctgtggggaccgctcctcaggcaagcactacggggtgtac
agctgcgagggctgcaagggcttcttcaagcggacggtgcgcaaggacctgacctacacc
tgccgggacaacaaggactgcctgatcgacaagaggaggccgagccccatccgaggccca
ggggccatagcacttgggaagtgccgggaggggctgcacccgtccgctgtccggaaggtg
ctgccccaggacattggatcaggaaagagagcactgagcgtggagtcccacgagagtgct
ggccggaagctgggccgtgggccagaggccctgcagctgtcagagtcagccaacctgagc
tggctgccgtgtgggagcgtgccctgggcaggttcagcttcccgcagacgtcactgtgtt
ctcttcatgctctgcccttgcatcccccagcagtgggctgggtaccaggccttctccatg
gtgcagctcggggtgcagtccgggactgtgcaggaggaacggcagcggggcaaggacagg
aacgagaacgaggtggagtccacgagcagtgccaacgaggacatgccggtggagaagatt
ctggaggcagagctggctgtcgagcccaagactgagacgtatgtggacgcgaacatgggg
ctgaaccccaactcgcccaacgaccctgtcaccaacatctgccaggcagcggacaagcag
ctcttcacgctggtcgagtgggccaagcggattccgcacttctcggagctgcccctggat
gaccaggtcatcctgctgagggcaggctggaatgagctgctcatcgcttccttctcccac
cggtccatcgccgtgaaggacgggatcctcctggccaccggactgcacgtccaccggaac
agcgcccacagcgcgggggtgggcgccatctttgacagggtgttgacggagctcgtgtcc
aagatgcgggacatgcagatggacaagactgagctgggctgcctgcgcgccatcgtgctc
ttcaaccccgactccaaggggctctcgaacccagccgaggtggaggcgctgagggagaag
gtctacgcgtccctggaggcgtactgcaaacacaagtaccccgagcagccgggaaggagg
gggtcgcacgtgccccagagacacgcacaaacctgctcaccacaatgctga

DBGET integrated database retrieval system