KEGG   Ursus maritimus (polar bear): 103658758
Entry
103658758         CDS       T03271                                 

Gene name
C1GALT1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00512  Mucin type O-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103658758 (C1GALT1)
   00514 Other types of O-glycan biosynthesis
    103658758 (C1GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103658758 (C1GALT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     103658758 (C1GALT1)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 3 chain
   103658758 (C1GALT1)
SSDB
Motif
Pfam: Fringe Galactosyl_T
Other DBs
NCBI-GeneID: 103658758
NCBI-ProteinID: XP_008684502
UniProt: A0A384BPK0
LinkDB
Position
Un
AA seq 359 aa
MASKSWLNFLTFLCGSAIGFVLCSQLFSILLGEQGDTQPNILHNDPHARHSDDNGQSHLE
GQMNFNADSSQHTDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPENILKDISRSYKNEEPKVK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctttgtggatcagcaattggattt
gttttatgttctcagctatttagtattttgttgggagaacagggtgatacccagcccaat
attcttcataatgatcctcatgctaggcattcagatgataatggacaaagtcatctagaa
ggacagatgaacttcaatgcagattctagccaacatacagatgagaacacagacatcgct
gaaaacctctatcaaaaggttaaaattctttgctgggttatgacagggcctcaaaatcta
gagaaaaaggccaaacacgtcaaagctacatgggcacagcgttgtaataaagtgttgttt
atgagttcggaagaaaataaagacttccctgccgtgggattaaaaaccagagaaggcaga
gaccaactatactggaaaacaattaaagcttttcagtatgttcatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacatatgttatactggataatttgaga
tggcttctctcaaaatacaaccctgaggaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagccttg
aagagatttgttgatgcatttaaaacagacaaatgtacacatagttcctccatcgaagac
ttagcattgggcagatgcatggaaattataaatgtagaagcaggagattccagagatacc
actggaaaagaaacttttcatccctttgtaccagagcaccacttaatcaagggttatcta
cctagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctgccttacct
gaaaatatactaaaagatataagtcgatcatacaaaaatgaagagccaaaagtaaaatga

KEGG   Ursus maritimus (polar bear): 103680219
Entry
103680219         CDS       T03271                                 

Gene name
C1GALT1C1
Definition
(RefSeq) C1GALT1 specific chaperone 1
  KO
K09653  C1GALT1-specific chaperone 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00512  Mucin type O-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103680219 (C1GALT1C1)
   00514 Other types of O-glycan biosynthesis
    103680219 (C1GALT1C1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103680219 (C1GALT1C1)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Type 3 chain
   103680219 (C1GALT1C1)
SSDB
Other DBs
NCBI-GeneID: 103680219
NCBI-ProteinID: XP_008707972
UniProt: A0A384DMI2
LinkDB
Position
Un
AA seq 318 aa
MLSESSSFLKGVMLGSIFCALITMLGHVRIGHGNRMHQHEHHHLQAPNKEDILKISEDER
MELSKSFRVYCIILVKPKDVSLWAAVRETWTKHCDKAEFFSSENVKVFESINMETDDIWL
MMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEY
VSVEGGIVLSIESMKRLNGLLGIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDS
EGKDVFNTKSVGLFIKEAMTNHPNLVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG
HIFHDALVFLPPNGSDND
NT seq 957 nt   +upstreamnt  +downstreamnt
atgctttctgaaagcagttcatttttgaagggtgtgatgctcggaagcattttctgtgcc
ttgatcactatgctaggacacgttaggattggtcatggaaatagaatgcaccagcatgag
catcatcacctgcaagcgcctaataaagaagatatcttgaaaatttcagaggatgaacgc
atggagctcagtaagagctttcgggtatactgcatcatccttgtaaaacccaaagatgtg
agtctttgggctgcagtgagggagacttggaccaaacactgtgacaaagcagagttcttc
agttctgaaaatgttaaagtgtttgagtcaattaacatggaaacagatgacatatggcta
atgatgagaaaagcttacaaatatgcctttgataaatacagagaccaatacaactggttc
ttccttgcacgccccactacgtttgctattattgaaaatttaaagtattttttgttaaaa
aaggatccatcacaacctttctatctaggccacactataaaatcgggagaccttgaatat
gtgagtgtagaaggaggcatcgtcttaagtatagaatcgatgaaaagacttaacggcctc
ctcggtatccctgaaaagtgtcctgaacagggagggatgatttggaagatatctgaagat
aagcagctagcagtctgcctgaaatacgctggggtgtttgcagaaaacgcagaagattct
gaaggaaaagatgtatttaataccaaatccgtcgggctttttattaaagaggcaatgact
aaccaccccaaccttgtggtagaaggatgctgttcagatatggctgttacttttaatgga
ctgactcccaatcagatgcatgtgatgatgtatggggtataccgtcttagggcatttgga
catattttccacgatgcattggttttcttacctccaaatggttctgacaatgactga

DBGET integrated database retrieval system