KEGG   Ursus maritimus (polar bear): 103658775
Entry
103658775         CDS       T03271                                 

Gene name
GNAI1
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04360  Axon guidance
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05133  Pertussis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103658775 (GNAI1)
   04371 Apelin signaling pathway
    103658775 (GNAI1)
   04071 Sphingolipid signaling pathway
    103658775 (GNAI1)
   04024 cAMP signaling pathway
    103658775 (GNAI1)
   04022 cGMP-PKG signaling pathway
    103658775 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103658775 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103658775 (GNAI1)
   04670 Leukocyte transendothelial migration
    103658775 (GNAI1)
   04062 Chemokine signaling pathway
    103658775 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103658775 (GNAI1)
   04915 Estrogen signaling pathway
    103658775 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    103658775 (GNAI1)
   04921 Oxytocin signaling pathway
    103658775 (GNAI1)
   04926 Relaxin signaling pathway
    103658775 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    103658775 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    103658775 (GNAI1)
   04916 Melanogenesis
    103658775 (GNAI1)
   04924 Renin secretion
    103658775 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103658775 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    103658775 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103658775 (GNAI1)
   04727 GABAergic synapse
    103658775 (GNAI1)
   04725 Cholinergic synapse
    103658775 (GNAI1)
   04728 Dopaminergic synapse
    103658775 (GNAI1)
   04726 Serotonergic synapse
    103658775 (GNAI1)
   04730 Long-term depression
    103658775 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    103658775 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    103658775 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103658775 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658775 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103658775 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    103658775 (GNAI1)
   05032 Morphine addiction
    103658775 (GNAI1)
   05034 Alcoholism
    103658775 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103658775 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103658775 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103658775 (GNAI1)
   05163 Human cytomegalovirus infection
    103658775 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103658775 (GNAI1)
   05142 Chagas disease
    103658775 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103658775 (GNAI1)
   04031 GTP-binding proteins [BR:umr04031]
    103658775 (GNAI1)
Exosome [BR:umr04147]
 Exosomal proteins
  Proteins found in most exosomes
   103658775 (GNAI1)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103658775 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 103658775
NCBI-ProteinID: XP_008684516
UniProt: A0A384BPJ3
LinkDB
Position
Un
AA seq 466 aa
MGPSPSSEPVAGRVSCSTALVLVLSLPGMLVTCSQAPGIGTWASLGAIIQPSTVCPLAAK
DLCKMHLLNPNISNSLSPSQHQHSVQNPILQISSSNSVWGSRRSRHHSMAAADSVGSALL
RSQEIFIETCATRRVARIPGGVGQEKVVDEGGAGESGKSTIVKQMKIIHEAGYSEEECKQ
YKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIK
RLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETH
FTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMK
LFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFE
DLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgggaccttctccatcgtcagaaccagtagctggtagagtctcatgtagcactgctctt
gtgctggtcctttcacttccagggatgctggtgacatgttcccaggctccagggattggg
acatgggcgtctttgggggccattattcagccttccacagtctgccccctggctgccaaa
gatttatgtaaaatgcatttactgaatcccaacatctccaacagtctcagcccatcacag
catcagcacagtgtccaaaatcccatcctccagatctcatcatcgaactcagtttgggga
tctagaaggtctcgtcatcacagcatggctgctgccgactcagttggcagtgctctgctg
agaagtcaagaaatattcatagaaacatgtgcaacgagaagggtggcaaggatccctggg
ggagtgggtcaggaaaaggtggttgatgaaggaggtgctggcgaatctgggaagagtaca
attgtgaagcaaatgaaaattatccacgaagctggttattcggaggaggaatgtaagcag
tacaaagcagtggtctacagtaacaccatccagtcaatcattgctatcatcagggccatg
gggcggttgaagatcgacttcggtgactcggctcgggcggatgatgcccgccaactcttt
gtgcttgctggagctgctgaagaaggttttatgactgcggaacttgctggagttataaag
agattgtggaaagatagtggtgtacaagcctgtttcaacagatcccgagagtaccagctt
aatgactccgcagcatactatttgaatgacttggacagaatagcacaaccaaattatatc
ccaactcaacaggatgttctcagaaccagagtgaaaacgacaggaattgttgaaacccat
tttactttcaaagatcttcattttaagatgtttgatgtgggagggcagagatctgagcgg
aagaagtggattcattgtttcgaaggagtgaccgccatcatcttctgtgtggcgctgagt
gactatgacctggttctagctgaagatgaagagatgaatcgaatgcatgaaagcatgaag
ttgttcgacagcatatgtaacaacaaatggtttacggatacatctattatactttttctc
aacaagaaggatctctttgaagaaaaaatcaaaaagagcccgctcactatatgctatcca
gaatatgcaggctcaaacacatatgaagaggcagctgcatatattcagtgtcagtttgaa
gacctcaataaaagaaaggacacaaaggaaatatacacccacttcacatgtgccacggat
actaagaatgtgcagtttgtttttgatgctgtaacagatgtcatcataaaaaataatcta
aaagattgtggtctcttctaa

KEGG   Ursus maritimus (polar bear): 103674803
Entry
103674803         CDS       T03271                                 

Gene name
GNAI2
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04360  Axon guidance
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05133  Pertussis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103674803 (GNAI2)
   04371 Apelin signaling pathway
    103674803 (GNAI2)
   04071 Sphingolipid signaling pathway
    103674803 (GNAI2)
   04024 cAMP signaling pathway
    103674803 (GNAI2)
   04022 cGMP-PKG signaling pathway
    103674803 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103674803 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674803 (GNAI2)
   04670 Leukocyte transendothelial migration
    103674803 (GNAI2)
   04062 Chemokine signaling pathway
    103674803 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103674803 (GNAI2)
   04915 Estrogen signaling pathway
    103674803 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    103674803 (GNAI2)
   04921 Oxytocin signaling pathway
    103674803 (GNAI2)
   04926 Relaxin signaling pathway
    103674803 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    103674803 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    103674803 (GNAI2)
   04916 Melanogenesis
    103674803 (GNAI2)
   04924 Renin secretion
    103674803 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103674803 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    103674803 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103674803 (GNAI2)
   04727 GABAergic synapse
    103674803 (GNAI2)
   04725 Cholinergic synapse
    103674803 (GNAI2)
   04728 Dopaminergic synapse
    103674803 (GNAI2)
   04726 Serotonergic synapse
    103674803 (GNAI2)
   04730 Long-term depression
    103674803 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    103674803 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    103674803 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103674803 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674803 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103674803 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    103674803 (GNAI2)
   05032 Morphine addiction
    103674803 (GNAI2)
   05034 Alcoholism
    103674803 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103674803 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103674803 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103674803 (GNAI2)
   05163 Human cytomegalovirus infection
    103674803 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103674803 (GNAI2)
   05142 Chagas disease
    103674803 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103674803 (GNAI2)
   04031 GTP-binding proteins [BR:umr04031]
    103674803 (GNAI2)
Exosome [BR:umr04147]
 Exosomal proteins
  Proteins found in most exosomes
   103674803 (GNAI2)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103674803 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 103674803
NCBI-ProteinID: XP_008701984
UniProt: A0A384D5B5
LinkDB
Position
Un
AA seq 303 aa
MKIIHEDGYSEEECRQYRAVGYSNPIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSC
TAEEQGVLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQ
QDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYT
GANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaagatcatccacgaggacggctactcagaggaggagtgccggcagtaccgggcggtc
ggctacagcaaccccatccagtccatcatggccattgtcaaagccatgggcaatctgcag
attgactttgccgacccctcccgagcggatgacgcccggcagctgtttgccctgtcctgc
actgccgaggagcaaggcgtgctccccgaggacctgtctggtgtcatccggaggctctgg
gctgaccatggcgtgcaggcctgctttggccgctctcgggagtaccagctcaatgactcc
gcggcctactacctgaatgacctggagcgcatcgcacagagtgactacatccccacacag
caggacgtgctacggacccgtgtgaagaccacgggcatcgtggagacgcacttcaccttc
aaggacctacacttcaagatgtttgatgtgggtggtcagcggtctgagcggaagaagtgg
atccactgcttcgagggtgtcacagccatcatcttctgcgtcgccttgagcgcctatgac
ctggtgctagctgaggacgaggagatgaaccgcatgcatgagagcatgaagctgtttgac
agtatctgcaacaacaagtggttcacagacacgtccatcatcctcttcctcaacaagaag
gacctgtttgaggagaagatcacacacagccccctgaccatctgcttccctgagtacaca
ggggccaacaagtacgacgaggcggccagctacatccagagcaagtttgaggacctgaac
aagcgcaaggataccaaggagatctacacgcacttcacgtgcgccaccgacaccaagaac
gtgcagttcgtgtttgatgccgtcaccgacgtcatcatcaagaacaacctgaaggactgc
ggcctcttctga

KEGG   Ursus maritimus (polar bear): 103675000
Entry
103675000         CDS       T03271                                 

Gene name
GNAI3
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04360  Axon guidance
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05133  Pertussis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103675000 (GNAI3)
   04371 Apelin signaling pathway
    103675000 (GNAI3)
   04071 Sphingolipid signaling pathway
    103675000 (GNAI3)
   04024 cAMP signaling pathway
    103675000 (GNAI3)
   04022 cGMP-PKG signaling pathway
    103675000 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103675000 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103675000 (GNAI3)
   04670 Leukocyte transendothelial migration
    103675000 (GNAI3)
   04062 Chemokine signaling pathway
    103675000 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103675000 (GNAI3)
   04915 Estrogen signaling pathway
    103675000 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    103675000 (GNAI3)
   04921 Oxytocin signaling pathway
    103675000 (GNAI3)
   04926 Relaxin signaling pathway
    103675000 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    103675000 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    103675000 (GNAI3)
   04916 Melanogenesis
    103675000 (GNAI3)
   04924 Renin secretion
    103675000 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103675000 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    103675000 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103675000 (GNAI3)
   04727 GABAergic synapse
    103675000 (GNAI3)
   04725 Cholinergic synapse
    103675000 (GNAI3)
   04728 Dopaminergic synapse
    103675000 (GNAI3)
   04726 Serotonergic synapse
    103675000 (GNAI3)
   04730 Long-term depression
    103675000 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    103675000 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    103675000 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103675000 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675000 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103675000 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    103675000 (GNAI3)
   05032 Morphine addiction
    103675000 (GNAI3)
   05034 Alcoholism
    103675000 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103675000 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103675000 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103675000 (GNAI3)
   05163 Human cytomegalovirus infection
    103675000 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103675000 (GNAI3)
   05142 Chagas disease
    103675000 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103675000 (GNAI3)
   04031 GTP-binding proteins [BR:umr04031]
    103675000 (GNAI3)
Exosome [BR:umr04147]
 Exosomal proteins
  Proteins found in most exosomes
   103675000 (GNAI3)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103675000 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 103675000
NCBI-ProteinID: XP_008702242
UniProt: A0A384D581
LinkDB
Position
Un
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggaagaatgtaaacaatataaagtagttgtctacagcaatactatccagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccaga
gcagatgacgcccggcaattatttgttctggccggcagtgccgaagaaggggtcatgact
ccagaactagcgggagtgattaaacggttatggcgggacggcggggtgcaagcttgcttc
agcagatcccgggagtatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgtcctgcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggaaatg
aaccgaatgcacgaaagcatgaaactgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaagagg
agtccactaactatctgttatccagaatacacgggttccaatacatatgaagaagcagct
gcttatattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacaccaagaatgtgcagtttgtttttgacgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttactga

DBGET integrated database retrieval system