KEGG   Ursus maritimus (polar bear): 103658871
Entry
103658871         CDS       T03271                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01523  Antifolate resistance
umr04060  Cytokine-cytokine receptor interaction
umr04061  Viral protein interaction with cytokine and cytokine receptor
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr04657  IL-17 signaling pathway
umr04659  Th17 cell differentiation
umr04668  TNF signaling pathway
umr04672  Intestinal immune network for IgA production
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05010  Alzheimer disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05134  Legionellosis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05144  Malaria
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05321  Inflammatory bowel disease
umr05323  Rheumatoid arthritis
umr05332  Graft-versus-host disease
umr05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103658871 (IL6)
   04668 TNF signaling pathway
    103658871 (IL6)
   04066 HIF-1 signaling pathway
    103658871 (IL6)
   04068 FoxO signaling pathway
    103658871 (IL6)
   04151 PI3K-Akt signaling pathway
    103658871 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103658871 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103658871 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103658871 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103658871 (IL6)
   04620 Toll-like receptor signaling pathway
    103658871 (IL6)
   04621 NOD-like receptor signaling pathway
    103658871 (IL6)
   04623 Cytosolic DNA-sensing pathway
    103658871 (IL6)
   04625 C-type lectin receptor signaling pathway
    103658871 (IL6)
   04659 Th17 cell differentiation
    103658871 (IL6)
   04657 IL-17 signaling pathway
    103658871 (IL6)
   04672 Intestinal immune network for IgA production
    103658871 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658871 (IL6)
   05202 Transcriptional misregulation in cancer
    103658871 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103658871 (IL6)
   05321 Inflammatory bowel disease
    103658871 (IL6)
   05332 Graft-versus-host disease
    103658871 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103658871 (IL6)
   05020 Prion disease
    103658871 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    103658871 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103658871 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103658871 (IL6)
   04931 Insulin resistance
    103658871 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103658871 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103658871 (IL6)
   05135 Yersinia infection
    103658871 (IL6)
   05133 Pertussis
    103658871 (IL6)
   05134 Legionellosis
    103658871 (IL6)
   05152 Tuberculosis
    103658871 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103658871 (IL6)
   05161 Hepatitis B
    103658871 (IL6)
   05171 Coronavirus disease - COVID-19
    103658871 (IL6)
   05164 Influenza A
    103658871 (IL6)
   05162 Measles
    103658871 (IL6)
   05168 Herpes simplex virus 1 infection
    103658871 (IL6)
   05163 Human cytomegalovirus infection
    103658871 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103658871 (IL6)
   05169 Epstein-Barr virus infection
    103658871 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103658871 (IL6)
   05144 Malaria
    103658871 (IL6)
   05142 Chagas disease
    103658871 (IL6)
   05143 African trypanosomiasis
    103658871 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103658871 (IL6)
   01523 Antifolate resistance
    103658871 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103658871 (IL6)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interleukins
   103658871 (IL6)
SSDB
Motif
Pfam: IL6 IL11 GCSF IL23
Other DBs
NCBI-GeneID: 103658871
NCBI-ProteinID: XP_008684599
UniProt: A0A384BQQ8
LinkDB
Position
Un
AA seq 210 aa
MNSLSTSAFSPVAFSLGLLLVMAPAPTPGHLGRDPKDEATSKRPPLISADKMEIIKYILG
RISALKKEMCDKYNKCEDSKEALAENNLHLPKLAEKDGCFQSGFNQDTCLTRIATGLLEF
QVHLKYLQANYEGDKENANSVYFSTKVLLQMLMEKVKNQDEVTTPDPTTDTGLQAILKSQ
DKWLKQTTIHLILQNFEDFLQFSLRAVRVM
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaagcgccttcagtccagttgccttctccctggggctgctcctg
gtgatggctcctgcccctaccccgggacacctgggaagagatcccaaagatgaggccacc
tcaaagagaccaccactcatctctgcagacaaaatggaaatcattaaatacatcctcggc
agaatctctgcactgaaaaaggagatgtgtgacaagtataacaagtgtgaagacagcaag
gaggcactggcagaaaacaacttacatcttccaaaactggcagaaaaggacggatgcttc
caatctgggttcaatcaggacacctgcctgacaagaatcgctaccggtcttctggagttt
caggtacacctgaaatacctccaggccaactatgaaggtgataaggaaaatgccaactct
gtgtacttcagtaccaaagtcctgctccagatgctgatggaaaaggtaaagaatcaggat
gaagtgaccaccccagaccccaccacagacaccggcctgcaggctatcctgaagtcgcag
gacaagtggctgaagcaaacaacaattcacctcatcctgcagaactttgaggatttcctg
cagttcagcctgagggcagtgcgggtcatgtag

DBGET integrated database retrieval system