KEGG   Ursus maritimus (polar bear): 103658932
Entry
103658932         CDS       T03271                                 

Gene name
CREB5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103658932 (CREB5)
   04024 cAMP signaling pathway
    103658932 (CREB5)
   04022 cGMP-PKG signaling pathway
    103658932 (CREB5)
   04151 PI3K-Akt signaling pathway
    103658932 (CREB5)
   04152 AMPK signaling pathway
    103658932 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103658932 (CREB5)
   04922 Glucagon signaling pathway
    103658932 (CREB5)
   04915 Estrogen signaling pathway
    103658932 (CREB5)
   04926 Relaxin signaling pathway
    103658932 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    103658932 (CREB5)
   04918 Thyroid hormone synthesis
    103658932 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    103658932 (CREB5)
   04925 Aldosterone synthesis and secretion
    103658932 (CREB5)
   04927 Cortisol synthesis and secretion
    103658932 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103658932 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103658932 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    103658932 (CREB5)
   04728 Dopaminergic synapse
    103658932 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    103658932 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    103658932 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103658932 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    103658932 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103658932 (CREB5)
   05020 Prion disease
    103658932 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    103658932 (CREB5)
   05031 Amphetamine addiction
    103658932 (CREB5)
   05034 Alcoholism
    103658932 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103658932 (CREB5)
   04934 Cushing syndrome
    103658932 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103658932 (CREB5)
   05161 Hepatitis B
    103658932 (CREB5)
   05163 Human cytomegalovirus infection
    103658932 (CREB5)
   05165 Human papillomavirus infection
    103658932 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103658932 (CREB5)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103658932 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 103658932
NCBI-ProteinID: XP_008684663
UniProt: A0A384BPZ0
LinkDB
Position
Un
AA seq 509 aa
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFNELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGGT
RMPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGTMSTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHH
PHPQPHHQQSHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQQVSPATQQMQPTQTIQPP
QPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQN
EVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPENSPPASPVPACSQQQVIQHNTI
TTSSAVSEVVGSSTLSQLTAHRTDLNPIL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccatttgtctgcagtgcc
ccgggctgctctcagcgcttcccaacagaggaccatctgatgattcataggcacaagcat
gaaatgactttgaagttcccctcaataaaaacagacaatatgttatcagatcagactccg
accccaacaagattcctgaagaactgcgaggaggtggggctcttcaatgagctggactgc
tccctcgagcatgagttcaggaaggctcaggaggaggagagcagcaagcggaatatctcg
atgcataacacagttggtggggccatggcggggcccggagctcaccagcttggcggcacc
cggatgcccaaccatgacaccagcgttgtgattcagcaagccatgccgtcaccccagtcc
agctctgtcatcacacaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatgcct
gggaccctgcccaacccgacgatgccgggatcttccgccgtcttgatgccaatggagaga
cagatgtcagtgaactccaacctcctgggaatgcaaggtccaaatctcagcaacccctgt
gcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggccgcgttg
actcaccaccctgctgccatgtcaaatgggactatgagcaccatgggacacatgatggaa
atgatgggctcccggcaggaccagacgccgcaccatcacatgcactcacacccgcatcag
caccagacactgccagcccatcacccgtacccacaccagcaccagcacccagcacaccac
cctcacccgcagccccaccaccagcagagccacccgcatcatcactcccactcccacctc
cacgcgcaccctgcacatcaccagacctcgccacacccgcccctgcactccggcaaccaa
gcacagcaggtctcaccagcaacgcaacagatgcagccaacccagacaatacagccgccc
cagcccacaggggggcgccggcgaagggtggtggacgaggatcccgatgagaggcggagg
aaatttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgg
gtgatgtcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaagtgtccatgttgaaaaatgaggtggcacagctgaaacagttgttgttaacgcataaa
gactgtccaataacagccatgcagaaagaatcacaaggatatctaagtcccgaaaacagc
cctcctgccagccccgtcccagcttgctcccagcagcaggtcatccaacataataccatc
accacttcctccgccgtgagcgaggtggtggggagctccacgctcagtcagcttacggct
cacagaacagacctgaatcccatcctttaa

KEGG   Ursus maritimus (polar bear): 103659593
Entry
103659593         CDS       T03271                                 

Gene name
ATF2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103659593 (ATF2)
   04668 TNF signaling pathway
    103659593 (ATF2)
   04022 cGMP-PKG signaling pathway
    103659593 (ATF2)
   04151 PI3K-Akt signaling pathway
    103659593 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103659593 (ATF2)
   04922 Glucagon signaling pathway
    103659593 (ATF2)
   04915 Estrogen signaling pathway
    103659593 (ATF2)
   04926 Relaxin signaling pathway
    103659593 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    103659593 (ATF2)
   04918 Thyroid hormone synthesis
    103659593 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    103659593 (ATF2)
   04925 Aldosterone synthesis and secretion
    103659593 (ATF2)
   04927 Cortisol synthesis and secretion
    103659593 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103659593 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    103659593 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    103659593 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103659593 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103659593 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    103659593 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    103659593 (ATF2)
   05031 Amphetamine addiction
    103659593 (ATF2)
   05034 Alcoholism
    103659593 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103659593 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103659593 (ATF2)
   05161 Hepatitis B
    103659593 (ATF2)
   05163 Human cytomegalovirus infection
    103659593 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103659593 (ATF2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103659593 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 103659593
NCBI-ProteinID: XP_008685379
UniProt: A0A384BS26
LinkDB
Position
Un
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPASQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcccaca
tcagctatcgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttccgac
tcaagtgtaattattcagcaagcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctattgcat
ctccctaatggacagaccatgcctgttgctattcctgcatcaattacgagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggtccttcctcccctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaagggcatggtagc
gggttggttagaacgcaatcagaggaatctcggccacagtcattgcaacagccagctaca
tctactacagaaactccggcttctccagctcacacaactccacagacccaaaatacaagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaagtttctagag
cgaaatagagcagcagcttcacgatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcataccgccgataaagatgatagttcagaagac
ctgtcagtgccaagtagtccacatacggaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcgacctccaaggccgaggctgtggccacctcggtgctcacgcagatg
gcggaccagagtacagagcctgcgctttcgcagattgttatggctcctgcctcccagtca
cagccctcaggaagttga

KEGG   Ursus maritimus (polar bear): 103659802
Entry
103659802         CDS       T03271                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04380  Osteoclast differentiation
umr04612  Antigen processing and presentation
umr04668  TNF signaling pathway
umr04710  Circadian rhythm
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103659802 (CREB1)
   04024 cAMP signaling pathway
    103659802 (CREB1)
   04022 cGMP-PKG signaling pathway
    103659802 (CREB1)
   04151 PI3K-Akt signaling pathway
    103659802 (CREB1)
   04152 AMPK signaling pathway
    103659802 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103659802 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    103659802 (CREB1)
   04922 Glucagon signaling pathway
    103659802 (CREB1)
   04915 Estrogen signaling pathway
    103659802 (CREB1)
   04926 Relaxin signaling pathway
    103659802 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    103659802 (CREB1)
   04918 Thyroid hormone synthesis
    103659802 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    103659802 (CREB1)
   04916 Melanogenesis
    103659802 (CREB1)
   04924 Renin secretion
    103659802 (CREB1)
   04925 Aldosterone synthesis and secretion
    103659802 (CREB1)
   04927 Cortisol synthesis and secretion
    103659802 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103659802 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103659802 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    103659802 (CREB1)
   04728 Dopaminergic synapse
    103659802 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103659802 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    103659802 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    103659802 (CREB1)
   04713 Circadian entrainment
    103659802 (CREB1)
   04714 Thermogenesis
    103659802 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103659802 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103659802 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103659802 (CREB1)
   05020 Prion disease
    103659802 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    103659802 (CREB1)
   05031 Amphetamine addiction
    103659802 (CREB1)
   05034 Alcoholism
    103659802 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103659802 (CREB1)
   04934 Cushing syndrome
    103659802 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103659802 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103659802 (CREB1)
   05161 Hepatitis B
    103659802 (CREB1)
   05163 Human cytomegalovirus infection
    103659802 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103659802 (CREB1)
   05165 Human papillomavirus infection
    103659802 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103659802 (CREB1)
   03029 Mitochondrial biogenesis [BR:umr03029]
    103659802 (CREB1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103659802 (CREB1)
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    103659802 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 103659802
NCBI-ProteinID: XP_008685652
UniProt: A0A384BST9
LinkDB
Position
Un
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggcgttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagagaaattctttcaaggagaccttcctacaggaaaattttgaatgac
ttatcttcagatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtgcagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
atcctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacatatcagattcgcacagcacccactagc
accatcgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaac
caaaataagacactcattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Ursus maritimus (polar bear): 103667087
Entry
103667087         CDS       T03271                                 

Gene name
CREB3
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103667087 (CREB3)
   04024 cAMP signaling pathway
    103667087 (CREB3)
   04022 cGMP-PKG signaling pathway
    103667087 (CREB3)
   04151 PI3K-Akt signaling pathway
    103667087 (CREB3)
   04152 AMPK signaling pathway
    103667087 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103667087 (CREB3)
   04922 Glucagon signaling pathway
    103667087 (CREB3)
   04915 Estrogen signaling pathway
    103667087 (CREB3)
   04926 Relaxin signaling pathway
    103667087 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    103667087 (CREB3)
   04918 Thyroid hormone synthesis
    103667087 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    103667087 (CREB3)
   04916 Melanogenesis
    103667087 (CREB3)
   04925 Aldosterone synthesis and secretion
    103667087 (CREB3)
   04927 Cortisol synthesis and secretion
    103667087 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103667087 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103667087 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    103667087 (CREB3)
   04728 Dopaminergic synapse
    103667087 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    103667087 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103667087 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103667087 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103667087 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103667087 (CREB3)
   05020 Prion disease
    103667087 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    103667087 (CREB3)
   05031 Amphetamine addiction
    103667087 (CREB3)
   05034 Alcoholism
    103667087 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103667087 (CREB3)
   04934 Cushing syndrome
    103667087 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103667087 (CREB3)
   05161 Hepatitis B
    103667087 (CREB3)
   05163 Human cytomegalovirus infection
    103667087 (CREB3)
   05165 Human papillomavirus infection
    103667087 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103667087 (CREB3)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103667087 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 103667087
NCBI-ProteinID: XP_008693413
UniProt: A0A384CEW9
LinkDB
Position
Un
AA seq 352 aa
MELALDLGDQDLLDFLLEESGDLGAEQPLSEALSEWETEDLLDSLLSPPTSLNVLSSSDS
CLVHHDHTYSLSQHVSIDLDGGNYGKEGAQTTPLRVEEPAEQEIARLILTDEEKRLLEKE
GLTLHGTLPLTKMEEQVLTRVRRKIRNKKSAQESRRKKKVYLGGLESRVLKYTAQNLELQ
NKVQLLEEQNLSLLDQLRRLQAMVIQISNKTSSSSTCVLVLLFSFCLLIVPAMYSSDTRG
SLPAEQGVLSRQLRALPSEDPHQLELPALQSEVPKDSSDQELQAPSNSCCLLYHMPQAPG
AEPPLKLPLPVLSSKPPCAGPILPLHANFTRDGGWLPTHSPTSVILQGRYSG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaactggcgttggacttgggtgaccaggacctgctggacttcctgctagaggaaagc
ggagatttgggggctgagcagccgctttccgaggcgctgagtgaatgggagacagaggat
ttactggattccctgttgagtcccccaacatcgttgaacgtccttagctcctctgattcc
tgtcttgttcaccatgatcacacctactctctctcacaacatgtctccatagatctagat
ggtggtaactatggaaaagagggggcgcagacgactccactgcgtgtggaggagccggca
gagcaggaaattgctaggctgatactgacagatgaggagaagaggctgttggagaaggag
gggcttacgctgcatgggacacttcctcttactaagatggaagagcaagttctgacacga
gtgcggaggaagattagaaacaaaaagtctgctcaagagagccgcaggaagaagaaggtg
tatttgggaggtttagagagcagggtcttgaaatacactgcccagaatctggagctacag
aacaaagtacagctcctggaggaacagaatttgtcccttctggaccagctgaggagactc
caggccatggtcattcagatatcgaacaaaacaagcagcagcagcacctgtgtcttggtc
ctacttttctcgttctgtctgctcatcgtacctgctatgtattcctctgacacaaggggg
agcctgccagctgagcagggagtgttgtcccgccagcttcgtgccctccccagtgaggac
cctcaccagctggagctgcctgccctgcagtcagaggtacccaaggacagctcagaccag
gagctccaggctcccagcaactcttgctgcctgctctaccacatgccccaggctcctggt
gctgagcctcccctgaagttgccacttcctgtcctttcctcaaagcctccctgcgcaggt
cccatccttcccctgcatgcaaatttcacaagagatgggggatggctccctactcacagc
cccacatctgttatcttacagggcagatattcaggctag

KEGG   Ursus maritimus (polar bear): 103668409
Entry
103668409         CDS       T03271                                 

Gene name
CREB3L4
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103668409 (CREB3L4)
   04024 cAMP signaling pathway
    103668409 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    103668409 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    103668409 (CREB3L4)
   04152 AMPK signaling pathway
    103668409 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103668409 (CREB3L4)
   04922 Glucagon signaling pathway
    103668409 (CREB3L4)
   04915 Estrogen signaling pathway
    103668409 (CREB3L4)
   04926 Relaxin signaling pathway
    103668409 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    103668409 (CREB3L4)
   04918 Thyroid hormone synthesis
    103668409 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    103668409 (CREB3L4)
   04916 Melanogenesis
    103668409 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    103668409 (CREB3L4)
   04927 Cortisol synthesis and secretion
    103668409 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103668409 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103668409 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    103668409 (CREB3L4)
   04728 Dopaminergic synapse
    103668409 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    103668409 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    103668409 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103668409 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103668409 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103668409 (CREB3L4)
   05020 Prion disease
    103668409 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    103668409 (CREB3L4)
   05031 Amphetamine addiction
    103668409 (CREB3L4)
   05034 Alcoholism
    103668409 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103668409 (CREB3L4)
   04934 Cushing syndrome
    103668409 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103668409 (CREB3L4)
   05161 Hepatitis B
    103668409 (CREB3L4)
   05163 Human cytomegalovirus infection
    103668409 (CREB3L4)
   05165 Human papillomavirus infection
    103668409 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103668409 (CREB3L4)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103668409 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf EMP24_GP25L HAUS-augmin3 Jnk-SapK_ap_N DUF2514 ZapB
Other DBs
NCBI-GeneID: 103668409
NCBI-ProteinID: XP_008694848
UniProt: A0A384CJ57
LinkDB
Position
Un
AA seq 396 aa
MDFRTPDLLDVWLEPPEEVSTGAFLELGLHCPPPEVPGTKLQEQGLRGWGPSGSRGRGGE
GTRESEPEDFLKLLIDPNEVYCSEASPGSDSGISEDPGHPDSPPAPKAPSSPALYEVVYE
AGGLERVQGEAEPAVGLISLQLDQRSPRLMVPDACTVRELPLAHAHTLPREGTVNPVPPA
TLLPCQTLFLTEEEKRLLGQEGVSLPTHLPLTKAEERALKKVRRKIRNKQSAQDSRRRKK
EYIDGLESRAAACSAQNQELQKKVQELERHNISLVTQLRQLQMLIAQTSNKAAQTSTCVL
ILLFSLALIILPSVSPLQGLREAGTEDHQPHGVISRNILTHKDMTENLETTVVQSRLEGP
PRAKDVNGSTRTLLEKMGGKTGSSGHIRTVLHADEM
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggacttccgaacccccgacctgctggatgtgtggctggagcccccagaagaggtttcc
acaggagccttcctggagctgggactgcactgcccccctccagaggtcccagggactaag
ctccaagaacaggggcttcgaggctgggggcccagcggcagccggggcagggggggggag
ggaaccagggagagtgagcctgaagatttcctgaagcttctcattgatcccaatgaggtg
tactgctccgaagcatctcctggcagtgacagcgggatctccgaggaccctggccatcca
gacagtcctcctgcccccaaagcacccagttcccctgctctctatgaggttgtctatgag
gcagggggcctggagagggtgcaaggggaagctgagccagctgtagggctcatctctctc
cagctagatcagcggagcccacgacttatggtgcctgatgcctgcacggtccgcgagctg
ccccttgctcacgctcacaccctgcccagagagggcactgtaaacccagtgcctcctgcg
accctactgccctgtcaaaccttgttcctgacagaggaagagaagcgtctgctgggacag
gaaggggtttccctgcccactcatctgcctctcaccaaggcagaggagagggccctcaag
aaggtcaggaggaagatccgtaacaagcagtcagctcaggacagtcggcgacggaagaaa
gagtacatcgacgggctagagagtagggcggctgcctgttctgcacagaaccaggaacta
cagaaaaaagtccaggagctggagagacacaatatctccctggtaactcagctccgccag
ctgcagatgctcattgcccaaacctccaacaaagctgcccagaccagcacttgtgttctg
atccttcttttttctctggctctcatcatcctgcccagtgtcagccccttgcagggtctc
cgggaagctgggactgaggatcaccagccgcatggagtgatttccagaaatatcctgact
cacaaggacatgacagaaaatttggagaccacagtggtacagtccagactggaggggcca
cctagggccaaggatgtaaatggctcaacaaggaccctccttgagaagatgggaggcaag
acaggctccagtgggcatatcagaacggtcctgcatgcagatgagatgtga

KEGG   Ursus maritimus (polar bear): 103669052
Entry
103669052         CDS       T03271                                 

Gene name
CREB3L2
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103669052 (CREB3L2)
   04024 cAMP signaling pathway
    103669052 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    103669052 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    103669052 (CREB3L2)
   04152 AMPK signaling pathway
    103669052 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103669052 (CREB3L2)
   04922 Glucagon signaling pathway
    103669052 (CREB3L2)
   04915 Estrogen signaling pathway
    103669052 (CREB3L2)
   04926 Relaxin signaling pathway
    103669052 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    103669052 (CREB3L2)
   04918 Thyroid hormone synthesis
    103669052 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    103669052 (CREB3L2)
   04916 Melanogenesis
    103669052 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    103669052 (CREB3L2)
   04927 Cortisol synthesis and secretion
    103669052 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103669052 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103669052 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    103669052 (CREB3L2)
   04728 Dopaminergic synapse
    103669052 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    103669052 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103669052 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103669052 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    103669052 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103669052 (CREB3L2)
   05020 Prion disease
    103669052 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    103669052 (CREB3L2)
   05031 Amphetamine addiction
    103669052 (CREB3L2)
   05034 Alcoholism
    103669052 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103669052 (CREB3L2)
   04934 Cushing syndrome
    103669052 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103669052 (CREB3L2)
   05161 Hepatitis B
    103669052 (CREB3L2)
   05163 Human cytomegalovirus infection
    103669052 (CREB3L2)
   05165 Human papillomavirus infection
    103669052 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103669052 (CREB3L2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103669052 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 103669052
NCBI-ProteinID: XP_008695599
UniProt: A0A384CM97
LinkDB
Position
Un
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTTGDSVNDDEVESEKWYLSTDF
PSTTIKTEPITEEPPPGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVEHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAVA
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSVQEPYT
ASVVRSRNLLIYEEHSPPEEPSSPASAGELGHWDRGASLLRASGLETRPDVDLPHFILSN
ETSLEKSVLLELQQHLVNAKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctcttatgtaccacacgcacttctcggaactcctg
gatgagttttcccagaacgtgttgggtcagctcctgaatgacccttttctgtccgagaag
agcgtgtcgatggaggtggagccatccccaacatccccggcgcctctcatccaggccgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccattcacccacgttaccacc
ggtgacagcgtcaatgacgatgaagtggaaagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccaataacagaggagccgcccccaggacttgtcccc
tctgtcactctgaccatcacagccatctccaccccttttgagaaggaggaaccccccctg
gaaatgaatactggggttgattcctcgtgccagaccattattcctaagattaagctggag
ccccatgaagtggatcagttcctcaacttctctcctaaagaagcctccgtggaacacctg
cacttacctcccacccctcccagcagccacagcagcgactcagagggcagcctgagcccc
aacccccgcctgcaccccttcggcctgcctcagacccacagccccgccagagccgtggcg
cgggccccctcggccctgtccagctctcctctcctcacagcgcctcacaaactgcaagga
tcaggcccactggtcctgactgaggaggagaagaggaccctgatcgccgagggctatccc
atccccaccaaattgcctctaacaaaatcagaggagaaggctctgaagaaaattcggagg
aaaatcaagaacaagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctggagaacaccaacagaactctcctgcagcaactgcagaagcttcagactttg
gtgatgggcaaggtttcacgcacctgcaagttggcgggcacgcagactggcacgtgcctc
atggtagttgtgctatgctttgctgttgcatttggcagcttctttcagggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattctgtgcaggagccatataca
gcctctgtcgtgagatccaggaatctgctgatctacgaggagcattctcccccggaggag
ccgtccagcccagcctcggccggggagcttgggcactgggacagaggggcctctctgctc
agagcgtcagggttggagaccaggcctgatgtggatcttccccatttcattctctcaaat
gagaccagcctggagaaatcagtgctgttggagctacagcagcacttggtcaacgccaaa
ctggaggggaacgagacactaaaagttgtagaactcgacagaagagtgaacgccactttc
taa

KEGG   Ursus maritimus (polar bear): 103672393
Entry
103672393         CDS       T03271                                 

Gene name
CREB3L1
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103672393 (CREB3L1)
   04024 cAMP signaling pathway
    103672393 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    103672393 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    103672393 (CREB3L1)
   04152 AMPK signaling pathway
    103672393 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103672393 (CREB3L1)
   04922 Glucagon signaling pathway
    103672393 (CREB3L1)
   04915 Estrogen signaling pathway
    103672393 (CREB3L1)
   04926 Relaxin signaling pathway
    103672393 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    103672393 (CREB3L1)
   04918 Thyroid hormone synthesis
    103672393 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    103672393 (CREB3L1)
   04916 Melanogenesis
    103672393 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    103672393 (CREB3L1)
   04927 Cortisol synthesis and secretion
    103672393 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103672393 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103672393 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    103672393 (CREB3L1)
   04728 Dopaminergic synapse
    103672393 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    103672393 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103672393 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103672393 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103672393 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103672393 (CREB3L1)
   05020 Prion disease
    103672393 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    103672393 (CREB3L1)
   05031 Amphetamine addiction
    103672393 (CREB3L1)
   05034 Alcoholism
    103672393 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103672393 (CREB3L1)
   04934 Cushing syndrome
    103672393 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103672393 (CREB3L1)
   05161 Hepatitis B
    103672393 (CREB3L1)
   05163 Human cytomegalovirus infection
    103672393 (CREB3L1)
   05165 Human papillomavirus infection
    103672393 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103672393 (CREB3L1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103672393 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 DUF724 ADIP
Other DBs
NCBI-GeneID: 103672393
NCBI-ProteinID: XP_008699317
UniProt: A0A384CWU8
LinkDB
Position
Un
AA seq 541 aa
MTVRLEMAAGVEGEVLVTAVTVIIEIIVGPGDMGGGDGGGINEAGKNNGAVAVTVVVHFP
EHLDHFAENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQ
SPLVPIKMEDTTQDVEHGAWVLGHKLCSVMVKQEQSPELPVDPLXXXXXXXXXXXTTPLL
GLSPLSRLPVPHQAPGEMTQPPVIKAEPQEVTQFLKVTPEDLVQMPLTPPSSHGSDSDGS
QSPRSLPPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPT
KLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETL
ENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSS
SSQTVKEDPMATDSVYTASQMPSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPA
EPRPQDHLQHDHLDSSHETTKYLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKL
S
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgacagtgaggctggagatggcagcaggggtggagggagaggtgctggtgacagcagtg
acggtcataatagaaataatagtgggtcctggggatatgggtggtggcgatggtggtggc
attaatgaggccgggaagaataatggagcggttgcagtgacggtggtggtgcacttcccg
gagcacctggaccactttgcggagaacatggaggacttctccaacgatctgttcagcagc
ttctttgatgaccccgtgctggacgagaagagccctctactggacatggaactggactcc
cccacaccaggcatccaggctgagcacagctactccctgagtggtgactcggcgcctcag
agtccccttgtgcccatcaagatggaggacaccacccaagacgtggaacacggagcatgg
gtgctgggacacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgccc
gtggaccctctgnngnnnnnnnnnnnnnnnnnnnnnnnnnnnnccaccactccgctgctg
ggcctcagccccctgtccaggctgcctgtcccccaccaggccccaggagagatgacgcag
ccgccagtgatcaaagcagagccccaggaggtgactcagttcctcaaagtgacaccagag
gacctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcc
cagagtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacg
gccatctccacctccccccttctcaccgcccctcacaaattacaggggacatcagggcca
ctgctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacg
aaactccccctcaccaaagctgaagaaaaggccttaaagagggtccggagaaaaatcaag
aataagatctcggcccaggagagccgccgtaagaagaaggagtacgtggaatgtctagaa
aagaaggtggagacgtttacatcagagaacaacgaactgtggaagaaggtagagaccctg
gagaatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaac
aagatctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggca
gccttgtgcttcgttctggtgctgggctccctcgtgccctgcctccctgagttctcctcc
agctcccagactgtgaaggaagaccccatggccacagacagcgtgtacacagccagtcag
atgccctcccggagcctcctgttctacgacgagggggcaggctcgtgggaggatggccgc
agtgccctgctgcctgtggagcccccagatggctgggaaatcaagccgggggggccggcc
gagcctcggccccaggaccacctgcagcatgaccacctggacagcagtcatgagaccacc
aagtacctgagtgaggcctggccaaaagacgtcggtggaaacggcaccagccccgacttc
tctcaccccaaggagtggttccgtgagagggatctgggccccaataccaccatcaaactc
tcctag

KEGG   Ursus maritimus (polar bear): 103676372
Entry
103676372         CDS       T03271                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04137  Mitophagy - animal
umr04141  Protein processing in endoplasmic reticulum
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04932  Non-alcoholic fatty liver disease
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103676372 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676372 (ATF4)
   04668 TNF signaling pathway
    103676372 (ATF4)
   04022 cGMP-PKG signaling pathway
    103676372 (ATF4)
   04151 PI3K-Akt signaling pathway
    103676372 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103676372 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    103676372 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103676372 (ATF4)
   04922 Glucagon signaling pathway
    103676372 (ATF4)
   04912 GnRH signaling pathway
    103676372 (ATF4)
   04915 Estrogen signaling pathway
    103676372 (ATF4)
   04926 Relaxin signaling pathway
    103676372 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    103676372 (ATF4)
   04918 Thyroid hormone synthesis
    103676372 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    103676372 (ATF4)
   04925 Aldosterone synthesis and secretion
    103676372 (ATF4)
   04927 Cortisol synthesis and secretion
    103676372 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103676372 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    103676372 (ATF4)
   04728 Dopaminergic synapse
    103676372 (ATF4)
   04720 Long-term potentiation
    103676372 (ATF4)
   04722 Neurotrophin signaling pathway
    103676372 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    103676372 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103676372 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103676372 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103676372 (ATF4)
   05012 Parkinson disease
    103676372 (ATF4)
   05014 Amyotrophic lateral sclerosis
    103676372 (ATF4)
   05020 Prion disease
    103676372 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    103676372 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    103676372 (ATF4)
   05031 Amphetamine addiction
    103676372 (ATF4)
   05034 Alcoholism
    103676372 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103676372 (ATF4)
   04934 Cushing syndrome
    103676372 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103676372 (ATF4)
   05161 Hepatitis B
    103676372 (ATF4)
   05163 Human cytomegalovirus infection
    103676372 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103676372 (ATF4)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103676372 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 MCU AAA_13 DUF3450 bZIP_Maf Nop53 Laminin_II
Other DBs
NCBI-GeneID: 103676372
NCBI-ProteinID: XP_008703764
UniProt: A0A384DAF2
LinkDB
Position
Un
AA seq 351 aa
MAEMSFLNSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFDSLFSIDDLETMPDELLATLDDTC
DLFDPLVQETNKEPPQSVNPIGHLPESLPKTDQIAPFTFLQPLPLSPGALSSTPDHSFSL
ELGSEVDISEGDRKSDSTAYITVIPQCIKEEDAPSDNDSGICMSPESYLGSPQHSPSTSR
GSPNRSLLSPGSHCGSARPKPYDPPGEKTAAKVKVEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagatgagtttcctgaacagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggagagcttgggtctcttagacgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttttcc
gggacagattggatggtggagaaaatggatctgaaggagtttgattttgattctctgttc
agtatagatgacctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctctttgaccccctagtccaggagacgaataaggagcccccccagagcgtgaaccca
attggccatctcccagaaagtttaccaaaaacagaccagattgccccctttaccttcctg
caaccacttccactttccccaggggccctgtcctccactccagatcattcttttagttta
gagctaggcagtgaagtggatatttctgaaggagatagaaagtcagactctactgcctac
attaccgtgatccctcagtgcataaaggaggaggatgccccctcagataatgacagtggc
atctgtatgagtcctgagtcctatctggggtccccccagcatagtccctctacctccagg
ggctctccaaataggagcctgctgtctccaggttcccattgtggttctgcccgccccaaa
ccctatgaccctcctggagagaagacggcagcaaaagtaaaggtcgagaaactagataag
aagctgaaaaagatggagcagaacaagactgcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggcgagtgtaaagagctggaaaagaagaatgaggctctg
aaagagagggcagattctttagccaaggagatccagtatctgaaagatttgatagaagag
gtccgaaaggcaagggagaagaaaagggtcccctag

KEGG   Ursus maritimus (polar bear): 103681679
Entry
103681679         CDS       T03271                                 

Gene name
CREB3L3
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04714  Thermogenesis
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04931  Insulin resistance
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr05016  Huntington disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103681679 (CREB3L3)
   04024 cAMP signaling pathway
    103681679 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    103681679 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    103681679 (CREB3L3)
   04152 AMPK signaling pathway
    103681679 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103681679 (CREB3L3)
   04922 Glucagon signaling pathway
    103681679 (CREB3L3)
   04915 Estrogen signaling pathway
    103681679 (CREB3L3)
   04926 Relaxin signaling pathway
    103681679 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    103681679 (CREB3L3)
   04918 Thyroid hormone synthesis
    103681679 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    103681679 (CREB3L3)
   04916 Melanogenesis
    103681679 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    103681679 (CREB3L3)
   04927 Cortisol synthesis and secretion
    103681679 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103681679 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103681679 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    103681679 (CREB3L3)
   04728 Dopaminergic synapse
    103681679 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    103681679 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103681679 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103681679 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103681679 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103681679 (CREB3L3)
   05020 Prion disease
    103681679 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    103681679 (CREB3L3)
   05031 Amphetamine addiction
    103681679 (CREB3L3)
   05034 Alcoholism
    103681679 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103681679 (CREB3L3)
   04934 Cushing syndrome
    103681679 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103681679 (CREB3L3)
   05161 Hepatitis B
    103681679 (CREB3L3)
   05163 Human cytomegalovirus infection
    103681679 (CREB3L3)
   05165 Human papillomavirus infection
    103681679 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103681679 (CREB3L3)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103681679 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB KASH_CCD DUF1664
Other DBs
NCBI-GeneID: 103681679
NCBI-ProteinID: XP_008709476
UniProt: A0A384DQZ3
LinkDB
Position
Un
AA seq 479 aa
MASSTGPMDPIGSLELLDLLFDQQDGILRHVELGEAWDHVEDQQVLPGPDSDDFLNSILA
SGDSVPSSPIWSPAASDSGISEDLPSDTQDTPPRSGTSATPTGCQTMETGKGLCPPYHPG
PACLASPPGPVAQVLEASVAIDLEMWSPSLCSEEQVEMADPPPSCNLTVKDLLLSGSGAA
DLQQHHLAAPHLLCPGAEHGQELVLTEDEKKLLAKEGLTLPTQLPLTKYEERVLKKIRRK
IRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIV
VQSTSKSAQTGTCVAVLLLSFALIVLPSISPFVAKKAENTGDYAPVRVFSRTLHNDAASR
VAPDATPGSEAPGPRSKDGISQERSPGSPIADWESQGMSALDNLTKGLDNSTLTPDNSTL
VPDNSTLSRNNSTLIQDNSTLVSDNSMEKQNGATLLGWTAPEPALSSGRVGLEAAGEEL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcttcctccactggtcccatggaccccattggcagcctggagctcctggatctcctg
tttgatcagcaggacggcatcctgagacatgtggagctgggtgaggcctgggaccacgtc
gaggaccagcaggtcctgccaggcccagactctgacgatttcctgaactccatcctggct
tctggagactcggtgcccagctccccgatctggtcccctgcagccagtgacagtggcatc
tctgaagacctgccctccgatacccaggacacccctccacgcagcgggacatccgccacc
cccaccggctgccagaccatggagacaggcaaagggctctgccccccctatcatcctgga
cccgcctgcctcgccagtccccctggaccggtggcccaagtgctggaggcctctgtggcc
atagacctggaaatgtggagcccgagcctctgttctgaggagcaggttgagatggcggac
ccacccccatcctgcaacctcactgtgaaagatctcctcctctccggcagcggcgccgcg
gacctgcagcagcatcacctggcggccccccacctgctgtgccccggggctgagcacggc
caggagctggtgctgacagaggacgagaagaagcttctggccaaagaaggcctcaccctg
cccacccagctgcccctcaccaagtatgaggagcgagtcctgaaaaaaatccgccggaaa
atccggaacaaacagtctgcccaagaaagccggaaaaagaagaaggaatatattgatggc
ctggaaactcggatgtcagcctgcactgcccagaaccaggagcttcagaggaaggtgttg
catctcgagaagcagaacctgtccctcttggagcagctgaagaaactccaggccattgtg
gtccagtccaccagcaagtcggcccagacgggcacctgcgtagcggtcctgctgctctcc
tttgccctcatcgtcctgccctccattagccctttcgtcgccaaaaaagccgagaacacc
ggagactacgcacctgttcgagttttctccagaactttgcacaacgacgctgcctcccgc
gtggcccccgacgccacaccaggctccgaagccccaggaccacggtccaaggatggcata
tcccaggaaaggtctccaggcagccccatagcggactgggaatctcagggcatgtcggct
ctggacaacttgacgaaggggctggacaactcgaccctgaccccagacaactccactctg
gtcccggacaactcgacactctcccggaacaattcgacactcatccaggacaactcgacg
ctcgtctcggacaactcgatggagaagcagaacggggccaccctgctgggctggactgca
cctgagccagcgctcagctctgggcgggtgggcttggaggcagcaggggaggagctgtga

KEGG   Ursus maritimus (polar bear): 103682282
Entry
103682282         CDS       T03271                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04141  Protein processing in endoplasmic reticulum
umr04151  PI3K-Akt signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103682282 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103682282 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103682282 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103682282 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103682282 (ATF6B)
   04915 Estrogen signaling pathway
    103682282 (ATF6B)
   04926 Relaxin signaling pathway
    103682282 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103682282 (ATF6B)
   04918 Thyroid hormone synthesis
    103682282 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103682282 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103682282 (ATF6B)
   04927 Cortisol synthesis and secretion
    103682282 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103682282 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103682282 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103682282 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103682282 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103682282 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103682282 (ATF6B)
   05031 Amphetamine addiction
    103682282 (ATF6B)
   05034 Alcoholism
    103682282 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103682282 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682282 (ATF6B)
   05161 Hepatitis B
    103682282 (ATF6B)
   05163 Human cytomegalovirus infection
    103682282 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103682282 (ATF6B)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103682282 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407
Other DBs
NCBI-GeneID: 103682282
NCBI-ProteinID: XP_008710086
UniProt: A0A384DSQ7
LinkDB
Position
Un
AA seq 701 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCPEQDVPFGS
SSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQASGVGE
VLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDASDVQTKVEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQISMGPSSDGSLGKALPTR
KPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQXA
DNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPA
PISPRMSGEQPQPRRHLLEFSTQEPIQGVEPLQGSSLGPEEPQPSTPGRPSFRNLTAFPG
GAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQL
RKKSPPVKAVPTQPLGPPERDPVGQLQLYRRPDRSQPEFLDAIDRREDTFYVVSFRRDHL
LLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTV
PPSLRKQPSSTPGNATGGPLPASAAGQAHQASHQPLYLNHP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggaactgatgctcctcagcgagattgcggacccaacacgttttttcacggacaac
ttgctgagcccggaggactggggtctgcggaacagcaccttgtacactggcctggatgat
gtggcggaggagcagacgcagctcttccgctgcccagagcaggatgtcccgtttggcagc
agctccctggatgtggggatggatgtcagcccccctgagccaccttgggaccccctgcct
atcttcccagatcttcaggtgaagtctgagccatcctccccctgctcctcttcctccctc
agctctgaatcatcccatctttccacagagccctccagccaggcttctggtgtaggagag
gtgctggttgtgaagacagagtccttggcacccccactctgcctcctaggagatgaccca
acatccccatttgaaactgtccagatcaatgtgggtcccacctctgatgacgcctcagat
gtccagaccaaggtagaacctgtctctccatcttcctccatcaactctgaggcttccctg
ctctcagcggagtcccccaaccaggcttttataggagaggaggtactggaagtgaagaca
gagtcaccgtcccctcaagggtgtctactgcaggatgtcctaggccccccacttggaggt
gtccagatcagcatgggcccatcctctgatggctccttaggcaaagcccttcccacccgg
aaaccacccctgcagcccaaacctgtggtgataaccaccgtcccaatgccacccagagct
gtgcctcccagcaccaccatccttttgcagccccttgtccagccacccccagtctcccca
gttgtcctcatccaaggtgctattcgggtccagcctgaggggccggcccccccggctcca
aggcctgagaggaagagcattgttccagcccctatgcctgggaactcctgcccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgc
cagtcacggaggaagaagaaggagtacctgcaggggctggaggctcggctgcagnnggcc
gacaaccagcagctccgccgggagaacgctgccctccggcggcggctggaggccctgctg
gctgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtc
ttccttctcttcatcgccttcaactttggacctgtcagcatcagtgagcctcctccggct
cccatctctcctcggatgagtggagagcagcctcagccccggagacatttgctggagttc
tcaacgcaagagccaattcagggagttgaacccctccagggttcctccctgggccctgag
gagccccagcccagcactccaggccggccaagtttcaggaacctgacagccttccccggg
ggtgccaaggagttgctgctgagagacctggaccagctcttcctctcctctgactgccgg
cacttcaaccgcaccgagtctctgaggcttgctgatgagctgagtggctgggtccagcgc
caccagagaggccggcggaagattcctcagagagcccaggagagacagaagtctcagcta
cggaagaagtcgcctccagttaaggcagtccccacccaacccctggggcccccagagagg
gatcctgtgggccagctgcagctgtatcgccgcccagaccgttcgcagccagaattcctg
gatgcaatcgaccgacgagaagacacgttttatgttgtgtccttccgaagggaccacttg
ctgctccctgccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcct
gccatggctcccaatgagaccctgtcaggccggggggccccgggggactatgaggagatg
atgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtg
cccccctcactccgaaaacagccatcctcgaccccgggcaatgccacaggtggccccttg
ccagcttctgcagccggccaggcccaccaggcctcccaccagcccctctacctcaatcac
ccctga

DBGET integrated database retrieval system