KEGG   Ursus maritimus (polar bear): 103659742
Entry
103659742         CDS       T03271                                 

Gene name
CASP8
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04668  TNF signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05134  Legionellosis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103659742 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103659742 (CASP8)
   04215 Apoptosis - multiple species
    103659742 (CASP8)
   04217 Necroptosis
    103659742 (CASP8)
   04115 p53 signaling pathway
    103659742 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103659742 (CASP8)
   04621 NOD-like receptor signaling pathway
    103659742 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    103659742 (CASP8)
   04625 C-type lectin receptor signaling pathway
    103659742 (CASP8)
   04657 IL-17 signaling pathway
    103659742 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103659742 (CASP8)
   05203 Viral carcinogenesis
    103659742 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103659742 (CASP8)
   05016 Huntington disease
    103659742 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    103659742 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103659742 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103659742 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103659742 (CASP8)
   05134 Legionellosis
    103659742 (CASP8)
   05152 Tuberculosis
    103659742 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103659742 (CASP8)
   05161 Hepatitis B
    103659742 (CASP8)
   05160 Hepatitis C
    103659742 (CASP8)
   05164 Influenza A
    103659742 (CASP8)
   05162 Measles
    103659742 (CASP8)
   05168 Herpes simplex virus 1 infection
    103659742 (CASP8)
   05163 Human cytomegalovirus infection
    103659742 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103659742 (CASP8)
   05169 Epstein-Barr virus infection
    103659742 (CASP8)
   05165 Human papillomavirus infection
    103659742 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103659742 (CASP8)
   05142 Chagas disease
    103659742 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103659742 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:umr01002]
    103659742 (CASP8)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     103659742 (CASP8)
Peptidases and inhibitors [BR:umr01002]
 Cysteine peptidases
  Family C14: caspase family
   103659742 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 103659742
NCBI-ProteinID: XP_008685573
UniProt: A0A384BTK5
LinkDB
Position
Un
AA seq 486 aa
MNFSKCLYNIGEQLDSDELASLKFLSMDYIPQKKQEPIKDPLMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLVTYLDTSKEEMEQELQIPGRAQISAYRVMLFQISEDVSKLELRSF
KFFLSQEISRCKLHDDLNLFDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LSREQTLSPQRSLDEISNDMSQLLVGEESLRVPPMSDSPGEQDCEPETSDKVYRMESKPR
GYCLIFNNYDFSIARKEVPKLQSIKDRNGTDLDADALCQTFSELHFEIVPFKDCTAKKIC
EVLKSYQSMDHSSRDCFICCILSHGDKGIIYGSDGQEVPIYELTSYFTGSKCPSLAGKPK
IFFIQACQGDNYQKGIAVETDSEQKEAYLEMDSSYQKRYIPEDADFLLGMATVNNCVSYR
NPMEGTWYIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDRKNMGKQMPQPTFTLRKK
LFFPLN
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaatttcagcaaatgcctctataatattggagaacagctggacagtgatgagctggcc
tccctcaagttcctgagcatggactacatcccacagaagaagcaggaacccatcaaggat
cccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacctgtcc
ttcttgaaggagctgcttttccgaattaacagactggacctgctggttacctacctggac
accagcaaggaggagatggagcaggagcttcaaataccaggcagagcccagatctctgcc
tacagggtcatgctttttcagatttcagaagatgtaagcaaattggaattgaggtccttt
aagttttttttgagccaggagatctccagatgtaaactgcacgatgacttgaacttgttt
gatattttcatagagatggagaagagggtcatcctcggggaaagaaatctggataccctg
aaaagaatctgtgaccaaattaacaagagcctgctgaagaaaatcacggattatgaagaa
ttaagcagagagcaaacactgagccctcaaagaagtctagatgaaatttcaaatgatatg
tctcagttgcttgtaggggaggaatccctgagggtaccgccaatgtcggactctccagga
gaacaggactgtgaaccagagacatcggacaaagtttaccgaatggaaagcaaacctcga
ggatattgtttgatctttaacaattacgactttagcatagcacggaaggaagtgcccaaa
cttcagagcattaaggataggaatggaacagacttggatgcagatgctttgtgtcagacc
tttagtgagcttcattttgagatcgtgcctttcaaagactgtacagccaagaaaatctgt
gaggttctgaaatcctaccaaagcatggaccactctagcagggattgcttcatctgctgc
atcctctcccatggagacaagggcatcatctatggctctgatgggcaagaagtccccatc
tatgagctgacttcttacttcactggttcaaagtgcccttcccttgcaggcaagcccaaa
atcttttttattcaggcttgtcaaggggataactaccagaaaggtatagctgttgagact
gactctgaacagaaggaggcctatttagaaatggactcatcctatcagaagagatatatc
ccagaagatgctgactttctgctggggatggccactgtgaataattgtgtttcctaccga
aaccccatggaggggacctggtatatccagtcactttgccagagcctgagagaaagatgt
cctaggggcgaagatattctcaccatccttaccgaggtgaactttgaagtgagcaataag
gatgacaggaaaaacatggggaaacaaatgccacaacctactttcacactgaggaaaaaa
ctctttttccctcttaattga

DBGET integrated database retrieval system