Ursus maritimus (polar bear): 103659828 Help Entry 103659828         CDS       T03271                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04024   cAMP signaling pathway umr04062   Chemokine signaling pathway umr04510   Focal adhesion umr04520   Adherens junction umr04611   Platelet activation umr04670   Leukocyte transendothelial migration umr04720   Long-term potentiation umr04722   Neurotrophin signaling pathway umr04934   Cushing syndrome umr04972   Pancreatic secretion umr05211   Renal cell carcinoma umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103659828    04014 Ras signaling pathway     103659828    04015 Rap1 signaling pathway     103659828    04024 cAMP signaling pathway     103659828  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103659828    04520 Adherens junction     103659828  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103659828    04670 Leukocyte transendothelial migration     103659828    04062 Chemokine signaling pathway     103659828   09154 Digestive system    04972 Pancreatic secretion     103659828   09156 Nervous system    04720 Long-term potentiation     103659828    04722 Neurotrophin signaling pathway     103659828  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     103659828   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103659828   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103659828  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103659828    04031 GTP-binding proteins [BR:umr04031]     103659828 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103659828   Exosomal proteins of other body fluids (saliva and urine)    103659828   Exosomal proteins of colorectal cancer cells    103659828 GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     103659828 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc AAA_16 AAA_29 Motif Other DBs NCBI-GeneID:  103659828 NCBI-ProteinID:  XP_008685695 UniProt:  A0A384BU62 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MAPAALRWGRKQRPGRSTRRGLVILGSGGTGKSTLTIQTEQFTAMRDLYMKSGQGFALVH SITAQSTFNDLQDLREQILHVKDTDDVAAILAGNKCDVEDERFIGKERGQNPARQWNNCA FLESSAKSKININEIFYDLVWQINRKTPVPGKALKKSASQLL NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggcaccagcagcactgcgttggggccggaagcagcgaccaggaaggagcacgaggcgt gggctagtcattcttggctcaggaggcactggaaaatctactctgactatacagacagaa caatttaccgcaatgagagatttatacatgaaaagtggacaaggctttgcattagttcac tccatcacagcacagtccacatttaatgatttacaagatctgagagagcagattcttcac gttaaagacactgatgatgttgcagcaattctggctggtaataagtgtgacgtggaagat gaaagatttataggaaaggaacgaggtcaaaatccagcaagacaatggaacaactgtgca ttcttagaatcttctgcaaaatcaaaaataaatattaatgagatcttttatgacctagtg tggcaaattaacagaaaaactccagtgcctgggaaggccctcaaaaagtcagcaagtcag ctactttaa

DBGET integrated database retrieval system