KEGG   Ursus maritimus (polar bear): 103659933
Entry
103659933         CDS       T03271                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04062  Chemokine signaling pathway
umr04217  Necroptosis
umr04380  Osteoclast differentiation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05140  Leishmaniasis
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05212  Pancreatic cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103659933 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103659933 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103659933 (STAT1)
   04621 NOD-like receptor signaling pathway
    103659933 (STAT1)
   04625 C-type lectin receptor signaling pathway
    103659933 (STAT1)
   04658 Th1 and Th2 cell differentiation
    103659933 (STAT1)
   04659 Th17 cell differentiation
    103659933 (STAT1)
   04062 Chemokine signaling pathway
    103659933 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103659933 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    103659933 (STAT1)
   04919 Thyroid hormone signaling pathway
    103659933 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103659933 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103659933 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103659933 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103659933 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103659933 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103659933 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103659933 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103659933 (STAT1)
   05160 Hepatitis C
    103659933 (STAT1)
   05171 Coronavirus disease - COVID-19
    103659933 (STAT1)
   05164 Influenza A
    103659933 (STAT1)
   05162 Measles
    103659933 (STAT1)
   05168 Herpes simplex virus 1 infection
    103659933 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103659933 (STAT1)
   05169 Epstein-Barr virus infection
    103659933 (STAT1)
   05165 Human papillomavirus infection
    103659933 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103659933 (STAT1)
   05140 Leishmaniasis
    103659933 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103659933 (STAT1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103659933 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 BLI1 DUF1633
Other DBs
NCBI-GeneID: 103659933
NCBI-ProteinID: XP_008685758
UniProt: A0A384BT48
LinkDB
Position
Un
AA seq 787 aa
MRTSRSHRAFEVSVCGVVPRHPGRRPSDPRSSRGEPGAGTRERQRRCASAHRCPTRRAEM
SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLL
SQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQR
FNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNRE
HEANGVAKNDQKQEQMLIQKMYLMLDNKRKEVVHKIIELLNVTELTQKALINDELVEWKQ
RQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQGL
WDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVK
VLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNE
GPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTEP
RNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWTR
FCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFLL
RFSESCREGAMTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSR
PKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEF
DSMMNAV
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgaggacaagtcgatcacacagagcattcgaagtctcagtctgcggagtggttccgcgg
cacccgggacgacgaccgtcggaccccagatccagcagaggcgaaccgggtgcgggaacc
cgggaaaggcagcgtcgctgcgcctccgcccaccgctgcccgacccggcgcgcagagatg
tcccagtggtatgagctccaacagcttgactccaaattcctggagcaggttcaccagctc
tatgatgacagttttcccatggaaatcagacagtacctggcacagtggctagaaaaacaa
gactgggagcatgctgctaatgacgtttcatttgccaccatccgatttcatgacctcctg
tcacagctggatgatcagtatagtcgcttttctttggagaataattttttgttgcagcat
aacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacagatg
tctatgatcatctgtaactgtctgaaggaggaaaggaagatcctggaaaatgcccagaga
ttcaatcaggcgcagtcggggaacattcagagcacggtgatgttagacaaacagaaggag
ctcgacagcaaagtcagaaatgtgaaagataaagttatgtgtatagagcatgaaatcaag
accctagaagatttacaagatgaatatgactttaagtgcaaaaccttgcagaacagagag
catgaagccaatggcgtggcaaagaatgatcagaaacaagagcagatgttaatccagaag
atgtatttaatgctcgacaataaaagaaaggaagtagttcacaaaataatagagttgttg
aatgttacggaacttacccagaaagccctgattaatgatgagctggtggaatggaagcag
agacagcagagtgcctgtattggggggccccccaacgcttgtcttgatcagctgcagaac
tggttcaccatcgttgcggagagtctgcagcaggttcgtcagcagcttaaaaagctcgag
gaattggaacagaagtacacctacgaacacgacccaatcacaaaaaacaaacaagggctg
tgggaccgcaccttcagccttttccagcagctcatccagagctcctttgtggtggaaaga
cagccttgcatgccaactcatcctcagaggccactggtcttgaagaccggggtccagttc
actgtgaagttgagactgctggtgaaattgcaagagctcaattacaatttgaaagtcaaa
gtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttagaaagttcaac
attttgggcacacatacgaaagtgatgaacatggaggagtccaccaatggaagtctggca
gcagaattccgacacctgcaactgaaagagcagaaaaatgccggcaccagaactaacgag
ggccctcttatcgttactgaagagcttcactcccttagttttgagacccagttgtgccag
cctggtttggtcattgacctcgagactacctctctgcccgttgtggtgatctccaacgtc
agccagctcccgagtggttgggcctccatcctctggtacaacatgctggtgacagaaccc
cggaacctgtccttcttcctgaacccaccctgtgcacgatggtcccagctctcggaggtg
ctcagctggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctcaacatg
ctaggagagaaactactcggtcctaatgctggccccgatggtctcattccgtggacaagg
ttctgcaaggaaaatataaatgataaaaattttcctttctggctttggattgaaagcatc
cttgaactcattaaaaaacacctgctctctctttggaatgatgggtgcatcgtgggcttt
atcagcaaggagcgagagcgcgcgctgctcaaggaccagcagccgggcacgttcctgctg
cgcttcagcgagagctgccgggaaggggccatgacgaagaaagaactttctgctgttact
ttccctgatattattcgcaattacaaagtcatggctgctgaaaatattccagagaatccc
ctgaagtatctgtatccgaatattgataaagaccatgcctttgggaaatattactccagg
ccaaaggaagccccagaaccaatggaactcgatggccctaaaggaactggatacatcaag
actgagttgatttctgtgtctgaagttcacccctctcgacttcagaccacagacaacctt
ctccccatgtcccctgaggagtttgacgaggtgtctcggatagtgggttccgtagagttc
gacagtatgatgaatgcagtatag

DBGET integrated database retrieval system