KEGG   Ursus maritimus (polar bear): 103660044
Entry
103660044         CDS       T03271                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04144  Endocytosis
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04510  Focal adhesion
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04730  Long-term depression
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103660044
   04014 Ras signaling pathway
    103660044
   04015 Rap1 signaling pathway
    103660044
   04066 HIF-1 signaling pathway
    103660044
   04068 FoxO signaling pathway
    103660044
   04151 PI3K-Akt signaling pathway
    103660044
   04152 AMPK signaling pathway
    103660044
   04150 mTOR signaling pathway
    103660044
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103660044
   04140 Autophagy - animal
    103660044
  09143 Cell growth and death
   04114 Oocyte meiosis
    103660044
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103660044
   04520 Adherens junction
    103660044
   04550 Signaling pathways regulating pluripotency of stem cells
    103660044
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103660044
   04914 Progesterone-mediated oocyte maturation
    103660044
  09156 Nervous system
   04730 Long-term depression
    103660044
  09149 Aging
   04211 Longevity regulating pathway
    103660044
   04213 Longevity regulating pathway - multiple species
    103660044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103660044
   05202 Transcriptional misregulation in cancer
    103660044
   05205 Proteoglycans in cancer
    103660044
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103660044
   05214 Glioma
    103660044
   05218 Melanoma
    103660044
   05215 Prostate cancer
    103660044
   05224 Breast cancer
    103660044
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103660044
   01522 Endocrine resistance
    103660044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103660044
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103660044
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103660044
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103660044
CD molecules [BR:umr04090]
 Proteins
  103660044
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Recep_L_domain Furin-like fn3 Kinase-like Furin-like_2 DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 103660044
NCBI-ProteinID: XP_008685869
UniProt: A0A384BUF8
LinkDB
Position
Un
AA seq 1149 aa
MKRRVFPPRLNETVTVVYNTVIASLLRAAEPPVTGHYYYAGVCVPTCPPNTYRFEGWRCV
DRDFCANIPSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKK
TKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALV
SLSFLKNLRQILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVS
EIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTWKNHIIIRWHRYRPPDY
RDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVDPGILLQGLKPWTQY
AVYVKAVTLTMVNDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPN
GNLSYYIVRWQRQPQDSYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGP
CCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVTQITNTTMSSRGRNST
VADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSAS
NFVFARTMPAEGADDIPGPVTWESRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRE
CVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKITYENFIHLII
ALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREK
ITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFN
CHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEIENNPVLAPPSLSKMIQMAGE
IADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRW
MSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCP
DMLFELMRMCWQYNPKMRPSFLEIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPE
NMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERA
LPLPQSSTC
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgaaacgcagggtatttcctccccgccttaatgaaactgtgactgtggtctataatact
gtcattgcaagtctgctccgggctgcagagccccctgtcactgggcattactactacgcc
ggcgtctgcgtgcccacctgcccgcccaacacctaccgcttcgagggctggcgctgcgtg
gaccgcgacttctgcgccaacatccccagcgccgagagcagcgactccgaggggttcgtg
atccacgacggcgagtgcatgcaggagtgcccctccgggttcatccggaatggcagtcag
agtatgtactgcatcccttgcgaaggtccttgccccaaggtctgtgaggaagagaagaaa
acaaagaccattgattctgttacctctgctcaaatgctccaaggatgcaccatcttcaag
ggcaatttgctcattaacatccgccgaggcaataacattgcctcggaactggagaacttc
atggggctcatcgaggtggtgacaggctacgtgaagattcgccattcccacgccttggtc
tccttgtccttcctaaaaaaccttcgccagatcttaggagaggagcagctggaggggaac
tactccttctacgtccttgacaaccagaacttgcagcagctgtgggactgggaccaccgc
aacctgaccatcaaagctgggaaaatgtactttgctttcaatcccaagttgtgcgtctcc
gagatttaccgcatggaggaagtgacagggactaaggggcgccagagcaaaggggacata
aacaccaggaacaacggagagcgagcctcctgtgaaagcgacgtcctgcacttcacctct
acgaccacatggaagaatcacatcatcataaggtggcaccgttaccggccccccgactac
agggacctcatcagcttcactgtctactacaaggaagcaccttttaaaaacgtcacggag
tacgatggccaggatgcctgtggctccaacagctggaacatggtggatgtggacctccct
cccaacaaggacgtcgatcctggcattttactgcagggactgaagccctggacgcagtat
gccgtgtatgtcaaggcggtgaccctcaccatggtgaacgaccacatccgtggggccaag
agtgaaatcttgtacattcgtaccaatgcttcagttccttccattcccctggacgttctg
tccgcgtccaactcgtcttctcagctcatcgtgaagtggaacccgccgtccctgcccaac
gggaacctcagttactacatcgtgaggtggcagcggcagcctcaggacagctacctgtac
cggcacaattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatc
gacgtcgaagaggtgacggagaatcccaagaccgaggtgtgcggcggagagaaggggcct
tgctgcgcctgccccaaaaccgaggccgagaagcaggccgagaaggaggaggccgagtac
cgcaaagtcttcgagaacttcctgcacaactccatctttgtgcccagaccggaaaggaag
cggagagacgtcacacaaatcaccaacaccaccatgtccagccgaggcaggaacagcaca
gtggcggacacctataatatcacagacccagaagagctcgagacagaataccctttcttt
gagagcagagtagataacaaggagagaactgtcatctctaacctccggccttttactttg
taccgcattgacatccacagctgtaaccatgaggctgagaagctgggctgcagcgcctcc
aactttgtttttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtg
acctgggagtcgaggcctgaaaactccatctttctaaagtggccagaacctgagaatccc
aatggattgattctaatgtatgaaataaaatacggatcacaaatcgaggatcagcgggaa
tgtgtatccagacaggagtacaggaaatatggaggcgccaagcttaaccggctcaacccg
gggaactatacagcccggatccaggccacctctctctccgggaatgggtcgtggacggat
cctgtgttcttctatgtcccagccaaaataacgtatgaaaacttcatccatctgatcata
gctctgcccgttgccgtcctgttgatagtgggagggctggttataatgttgtacgtcttc
cacaggaaaagaaataacagcaggctggggaatggagtgctgtacgcgtccgtgaaccca
gagtacttcagcgccgccgacgtgtacgtacctgacgagtgggaggttgctcgagagaag
atcaccatgagccgagagctgggccagggctcctttgggatggtatacgaaggagtcgcc
aaaggcgtggttaaagatgagcccgaaaccagggtggccattaaaacagtgaacgaggct
gcgagcatgcgcgaaaggattgaatttctcaatgaggcttcagtgatgaaggagttcaat
tgtcaccacgtggtgcggttgctgggcgtggtgtcccagggccagccgacgctggtcatc
atggaactgatgacacggggggatctcaaaagctatctcaggtctctgaggccagaaata
gagaataatccagtcctagcacctccaagcctgagcaagatgatccagatggctggggag
attgcagatggcatggcatacctcaacgccaacaagtttgtccacagagaccttgctgcc
cggaactgcatggtggccgaagatttcacggtcaaaatcggagatttcggtatgacaaga
gacatctatgagacagactattacaggaaaggaggaaaggggctgctgcctgtgcgctgg
atgtcccccgagtctctcaaggatggagtcttcaccactcactctgacgtctggtccttc
ggggtcgtgctctgggagattgccacgctggccgaacagccataccagggcttgtccaac
gagcaggtccttcgcttcgtgatggagggcggccttctggacaagccggacaactgcccc
gacatgctgtttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttcc
ttcctggagatcatcagcagcatcaaggacgagatggagcccggcttccgggaggtctcc
ttctactacagcgaggagaacaagccgcccgagccggaggagctggacctggagcccgag
aacatggagagcgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgac
agacactcaggacacaaggccgagaacggcccaggccccggcgtgctggtcctccgagcc
agcttcgatgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggcc
ttgcctctgccccagtcttcgacctgctga

DBGET integrated database retrieval system