KEGG   Ursus maritimus (polar bear): 103660447
Entry
103660447         CDS       T03271                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00564  Glycerophospholipid metabolism
umr00565  Ether lipid metabolism
umr01100  Metabolic pathways
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04666  Fc gamma R-mediated phagocytosis
umr04724  Glutamatergic synapse
umr04912  GnRH signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103660447 (PLD2)
   00565 Ether lipid metabolism
    103660447 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103660447 (PLD2)
   04072 Phospholipase D signaling pathway
    103660447 (PLD2)
   04071 Sphingolipid signaling pathway
    103660447 (PLD2)
   04024 cAMP signaling pathway
    103660447 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103660447 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103660447 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103660447 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    103660447 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103660447 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103660447 (PLD2)
   05231 Choline metabolism in cancer
    103660447 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103660447 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103660447 (PLD2)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     103660447 (PLD2)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103660447 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    103660447 (PLD2)
SSDB
Motif
Pfam: PX PLDc PLDc_2 PH PH_2
Other DBs
NCBI-GeneID: 103660447
NCBI-ProteinID: XP_008686287
UniProt: A0A384BUN4
LinkDB
Position
Un
AA seq 909 aa
MRAVLWDKSLFPSGGDLDSSQLHMEPDELDTLREGEDPADRMHPFLAIYDLQPLKMHPLV
FAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGAFTWTTKKKFRHFQELHRDLLRHK
VLMSLLPLARFGVAHPPDGEAANREIPSLPRAGPEGSSRHASSKQKYLENYLNRLLTMSF
YRNYHAMTEFLEVSRLSFIPDLGSKGLEGVIRKRSGGHHVPGLTCCGRDQVCYRWSKRWL
VVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCGSYRQ
ARWWGQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEE
IFITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALGINSGYSKR
ALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFMGGLDLAYGRWDDLHYRLTDLGDP
SGPAASQPAPLGPDSPGHPDLSQNQLFWLGKDYSNLIAKDWVQLDRPFEDFIDRETTPRM
PWRDVGVAVHGLPARDLARHFIQRWNFTKMTKAKYKIPMYPYLLPKSTSTADQLPFTLPG
GQCATVQVLRSVDRWSAGTLENSILNAYLGPGWGGSPPLTPAPFPRQGQCFRVYVLLPLL
PGFEGDITTGGGNSIQAILHFTYRXPPMAIHRCPCPDAVPIPSCWTFEVHLCGLRTHGEL
GGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTEMEPSLMDGR
EYQAGRFALSLRKHCFSVILGADARTDLDLRDPVCDDFFQLWQDTAENNANIYEQIFRCL
PSNATRSLRALREYVAVEPLAMVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKE
GVMPLEVWT
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgcgggccgtgctgtgggacaagagcctcttcccctctgggggcgacctggactccagc
cagctgcacatggagcccgacgagttggacactctgagggagggagaggacccagctgac
cggatgcacccttttctggccatctacgacctgcagcctctgaaaatgcacccgttggtg
ttcgcccctggggtcccggtcacggcccaagtggtgggcactgagagatacaccagcgga
tccaaggtgggaacgtgcaccttgtattctgtccgcttgacacatggcgcctttacctgg
accaccaagaagaagttccgtcatttccaggagctgcaccgggacctcctgagacacaaa
gtcttgatgagtctgcttcccctggcgcgctttggtgtggcccaccctccagacggagag
gcagccaaccgagagataccctctctgccacgagcgggtcctgagggctccagcagacat
gcgtccagcaaacagaagtacctggagaattacctcaaccgcctcctgaccatgtctttc
taccgcaactaccacgccatgacagaattcctggaagtcagtcggctgtcctttatcccc
gaccttggctccaagggactggagggagtgatccggaagcgttcgggcggccaccatgtt
cctggcctcacatgctgtggccgagaccaagtttgttaccgctggtccaagaggtggctg
gtggtgaaggactccttcctgctgtacatgtgcctggagacgggcgccatctcctttgtt
cagctcttcgaccccggcttcgaggtgcaggtggggaaaaggagcacagaggcacgctac
ggggtcaggatagacacctcccacaggtccctgattctcaagtgcggcagctaccggcag
gcacggtggtggggccaggagatcaccgagctggcccagggcccgggcagagacttcatt
cagctgcaccggcatgacagctatgccccgccccggccggggaccttggcccggtggttt
gtgaatggggcaggttactttgctgctgtggcagatgccatcctacgagcacaagaggag
attttcatcacagattggtggttgagtcctgagatttacctgaagcgtccggcccattca
gatgactggagactggacattatgcttaagaagaaggcggaggagggtgtccgcgtgtcc
gtcctgctgtttaaggaagtggagttggccttgggcattaacagcggctatagcaagagg
gcgttgatgctgctgcaccccaacattaaggtaatgcgccaccccgaccaggtgaccctg
tgggcccatcatgagaagctcctggtcgtggaccaagtggtggccttcatgggggggctg
gacctcgcctatggccgctgggatgacctacactaccgcctgactgacctcggggacccc
tctggaccagcggcctctcagcctgccccgctgggccccgactctccaggccacccagac
ctctcccagaaccaactcttctggctgggcaaggactacagcaatcttatcgctaaggac
tgggtgcagctggaccggccttttgaggatttcattgacagggagaccacaccccggatg
ccatggcgggacgttggggtggccgtgcacggtctgcccgcccgggacctggcccgacat
ttcatccagcgctggaacttcaccaagatgaccaaggccaagtacaagatacccatgtac
ccctacctgttgcccaaatccaccagcacggcagaccagctccccttcacactcccgggg
gggcagtgtgccaccgtacaggtgttgcggtcagtggaccgctggtccgcagggactttg
gagaattccatcctcaatgcctacttggggccgggctggggggggtccccgcctctgacc
cccgcgcccttccccagacaggggcagtgcttccgagtctacgtgcttttgcccctgctg
cccggttttgagggtgacatcactacaggtggtgggaattccatccaggccattctgcac
ttcacctacaggtgaccccccatggccatccatcggtgcccctgtcctgacgctgtcccg
atcccttcctgctggacttttgaggtccacctctgtgggcttcgcactcacggagagctg
ggtgggcacccggtctcagagctcatctatattcacagcaagatgctcatcgcggatgac
cggacagtcatcatcggctccgccaacatcaatgaccgcagcttgctgggcaagcgggac
agtgagctggccgtgctgatcgaggacacggagatggagccatccctcatggacggccgg
gaatatcaggcgggcaggttcgccttgagtttgcggaagcattgcttcagtgtgattctt
ggggcagatgcccggacagacctggatctccgagaccctgtctgtgatgacttcttccag
ctgtggcaagacacagctgagaacaacgccaacatctatgagcagatcttccgctgcctg
ccatccaatgccacacgctccctgcgggcgctccgggagtacgtggccgtggagcccctg
gccatggtcagcccccctctggccaggtctgagctcacccaggtccagggccacctggtc
cactttcccctcaagttcctggaggacgagtctttgctgccccccctggggagcaaggaa
ggcgtgatgcccctcgaagtgtggacatag

KEGG   Ursus maritimus (polar bear): 103676145
Entry
103676145         CDS       T03271                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00564  Glycerophospholipid metabolism
umr00565  Ether lipid metabolism
umr01100  Metabolic pathways
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04666  Fc gamma R-mediated phagocytosis
umr04724  Glutamatergic synapse
umr04912  GnRH signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103676145 (PLD1)
   00565 Ether lipid metabolism
    103676145 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103676145 (PLD1)
   04072 Phospholipase D signaling pathway
    103676145 (PLD1)
   04071 Sphingolipid signaling pathway
    103676145 (PLD1)
   04024 cAMP signaling pathway
    103676145 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103676145 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103676145 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103676145 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    103676145 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103676145 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676145 (PLD1)
   05231 Choline metabolism in cancer
    103676145 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103676145 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103676145 (PLD1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     103676145 (PLD1)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103676145 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    103676145 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PLDc PX PH DUF3785
Other DBs
NCBI-GeneID: 103676145
NCBI-ProteinID: XP_008703553
UniProt: A0A384D924
LinkDB
Position
Un
AA seq 1100 aa
MCLQCLARRRRSVNDSPFALTLSEANMSLKNEPRVNTSALQKIAADMSNLIENLDTRELH
FEGEEVDYDVSPSDPKTQEACIPFSAIYKTQGFKEPNIQTYLSGCPIKAQVLEVERFTST
TRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVK
EEPREMPSLPRSSENMIREEQFFGRRKQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFI
HDLGPKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAF
VLLVDKEFKIKVGKKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTDF
LKDHRFGSYAAVQENTLAKWYVNAKGYFEDVASAMEEAEEEIFITDWWLSPEIFLKRPVV
EGNRWRLDCILKRKAQQGVRIFVMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHV
SSSVYLWAHHEKLVVIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTVGSSLGSFTA
ETTGSMESLSLKDKNEPSKNPPTLKSVDDMDSKLKGIGKSRKFSTFSLYRQLHRQHVHKA
DSVSSLDSASSYCNHCRSRQNLIHGLKPHLKLFRSSSKSEQGLARPDVDTSSVRSLQTGM
GELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVA
RHFIQRWNFTKIMKSKYRSLSYPFLLPKSQTTAHELKYQVPGSVSASVQLLRSAADWSAG
IKYHEESIHTAYVHVIENSKHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENFR
YRVYVVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLNAKLGNQWINYIS
FCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDT
ETVPSVMDGEEYQAGRFAQGLRLQCFRVVLGYLSDPSENIQDPVSDKFFKEVWVATAARN
ATIYDKVFRCLPNDEVHNLIQLRDFITKPILAREDPIRAEEELKKIRGFLVQFPFYFLSE
ESLLPSVGTKEAIVPTEVWT
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgtgccttcagtgcttggcccggcggaggcgctcagtaaatgacagcccctttgctctt
accctgtcagaagccaacatgtccctgaaaaatgagccaagagtaaatacctctgcactg
cagaaaatcgctgctgacatgagtaatttgatagaaaatctggacacgcgggagctgcac
tttgagggagaggaggtggattacgatgtgtctcccagcgatcccaagacacaggaagcg
tgtattccgttctctgctatttataagactcaaggatttaaggagcctaacatacagacg
tatctctccggctgtccaataaaagcccaagtcctggaagtggaacgctttacgtctaca
acaagggtaccaagtatcaatctttacactattgaattaacacatggggagtttaagtgg
caagttaagaggaaattcaagcactttcaagaatttcacagagagctgctcaagtacaaa
gcttttatccgaatccccattcccactagaaggcacacatttagaagacagaatgtcaaa
gaagagcctcgagagatgccaagtttgccccgttcatctgaaaacatgatcagagaagaa
caattctttggcagaaggaaacaactggaagattatttgacaaagctactaaaaatgccc
atgtatagaaactaccatgcgacaacagaattccttgacataagccagctgtctttcatc
catgatttgggaccaaagggcatagaaggtatgataatgaaaagatccgggggacacaga
ataccaggcttgaattgctgtggtcagggaagagcctgctaccgctggtcaaaaaggtgg
ttgatagtgaaagattcatttttattatatatgaagccagacagcggtgctattgccttt
gtgctgctggtagataaagaattcaaaattaaggtggggaagaaggagacagagacgaaa
tatgggctccgaatcgataatctttcaaggacacttattttaaaatgcaacagctataga
catgctcggtggtggggaggggctatagaagaattcatccagaaacacggcaccgacttt
ctcaaagaccatcgatttgggtcgtatgctgctgtccaggagaatactttagctaaatgg
tacgttaatgccaaagggtattttgaagatgtggcaagtgctatggaagaggcagaagaa
gagatttttatcacggattggtggttgagtccagaaatcttcctgaaacgcccggtggtt
gaaggaaatcgttggaggttggactgcattctcaagcgaaaagcacaacagggagtgaga
atctttgtaatgctgtacaaagaggtagaacttgctctcggaatcaacagtgaatatagc
aagaggactctcatgcgtctacaccccaacataaaggtgatgaggcacccagatcatgta
tcatccagtgtatatctatgggctcatcatgagaaacttgttgtcatcgaccagtcagtg
gcctttgtgggtgggattgacctggcctatggaaggtgggatgacaatgaacacagactc
acagacgtgggcagtgtgaagcgtgtcaccgtaggatcgtctctgggttccttcactgct
gaaacaacagggtccatggaatccttgagcctcaaagacaaaaatgaacctagtaaaaat
ccgcctaccctgaagagtgttgatgatatggattcaaaactgaaaggaataggaaagtcc
agaaagttctctacattcagcctctacaggcagctgcacaggcagcacgtacacaaggcg
gacagcgtcagcagcctggacagcgcctccagttattgtaatcactgtagaagtcgtcag
aatttaatccatggtttaaaaccccacctgaaactctttcgctcctccagtaagtctgag
cagggcctcgctagacctgacgtggacaccagctccgtccgcagtttgcagacaggcatg
ggagagctccatggggagaccaggttctggcatgggaaggactactgcaattttgtcttc
aaagactgggttcaactggataagccttttgctgatttcattgacagatactccactccc
cggatgccgtggcatgacattgcgtctgcggtccacgggaaggcggctcgtgacgtggcc
cgtcacttcatccagcgctggaacttcacgaagattatgaagtccaaatatcggtccctc
tcttatcctttcctgcttcccaaatcgcaaacaacagcccatgagttgaaatatcaagtg
cctgggtccgtcagtgccagtgtacagctgcttcgctccgctgctgactggtcggctggt
ataaagtaccatgaagagtccatccacactgcttacgtccacgtgatagagaacagcaag
cactacatctatatagaaaaccagtttttcataagttgcgctgatgacaaagttgtgttc
aacaagataggtgatgccattgctcagaggatactgaaagctcacagagagaattttaga
taccgggtgtatgtggtgatcccactgctgccagggtttgaaggagacatctcaaccggt
ggaggaaacgctctgcaggcaataatgcacttcaactacaggaccatgtgcagaggagaa
aattccatccttggacaattaaacgcaaagcttggcaatcagtggataaattacatatca
ttctgtggccttagaacacatgcagagcttgaaggaaatctagtcactgagctcatctac
gtccacagcaagttgctaattgctgatgacaacactgttattattggctctgccaacatc
aacgaccgaagcatgctgggaaagcgtgacagtgaaatggctgtcattgtgcaggacacg
gagacggtcccttcggtgatggacggagaagagtaccaggctggccgcttcgcccaggga
cttcggctgcagtgcttcagggttgtccttggctatctttctgacccaagtgaaaacatt
caggatccagtgagtgacaaattcttcaaggaggtgtgggttgcaacggcagctcgaaat
gctacaatttatgataaggtgttccggtgccttcccaatgatgaagtacacaatttaatt
caactgagagactttataaccaagcccatcttggcaagggaagatcccattagagctgag
gaagaactgaagaagatccgcgggttcttagtgcaattccccttttatttcctgtctgaa
gaaagcctactgccttccgttggaaccaaagaagccatagtgcccacagaggtttggact
taa

DBGET integrated database retrieval system