KEGG   Ursus maritimus (polar bear): 103660837Help
Entry
103660837         CDS       T03271                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04146  Peroxisome
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103660837 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103660837 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    103660837 (SOD2)
   04213 Longevity regulating pathway - multiple species
    103660837 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    103660837 (SOD2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103660837 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103660837
NCBI-ProteinID: XP_008686725
LinkDB All DBs
Position
Un
AA seq 219 aa AA seqDB search
MNYGCTSRTLVPALGSLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLN
AIEEKYLEALEKGDITAQVALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKR
DFGSFEKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGID
VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaattatggctgcacgagcaggacgctggtgccggcgctggggtcgctgggttccagg
cagaagcacagcctccccgacttgccgtacgattatggcgccctggagcctcacatcaac
gcccagatcatgcagctgcaccacagcaagcaccacgcgacctacgtgaacaacctgaat
gccatcgaggagaagtatctggaggcgctggagaaaggtgacattacagctcaggtagct
cttcagcctgggctcaagttcaatggcggaggccatatcaatcattccatcttctggaca
aacctgagccctaagggtggtggagaacccaaaggggaattgctggaggccatcaaacgt
gattttggttccttcgaaaaatttaaggagaagttgaccactgtatctgttggcgtccaa
ggctcaggttggggttggcttggtttcaataaggaacagggacgcttgcagattgctgct
tgttctaaccaggatccgctgcaaggaacaacaggtcttattccactactggggatcgat
gtgtgggagcacgcttattaccttcagtataaaaatgtcagaccagattacctaaaagct
atttggaatgtaatcaactgggagaatgtaacggagagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system