KEGG   Ursus maritimus (polar bear): 103661184Help
Entry
103661184         CDS       T03271                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00010  Glycolysis / Gluconeogenesis
umr00053  Ascorbate and aldarate metabolism
umr00071  Fatty acid degradation
umr00280  Valine, leucine and isoleucine degradation
umr00310  Lysine degradation
umr00330  Arginine and proline metabolism
umr00340  Histidine metabolism
umr00380  Tryptophan metabolism
umr00410  beta-Alanine metabolism
umr00561  Glycerolipid metabolism
umr00620  Pyruvate metabolism
umr01100  Metabolic pathways
Module
umr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103661184 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103661184 (ALDH2)
   00620 Pyruvate metabolism
    103661184 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103661184 (ALDH2)
   00561 Glycerolipid metabolism
    103661184 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103661184 (ALDH2)
   00310 Lysine degradation
    103661184 (ALDH2)
   00330 Arginine and proline metabolism
    103661184 (ALDH2)
   00340 Histidine metabolism
    103661184 (ALDH2)
   00380 Tryptophan metabolism
    103661184 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103661184 (ALDH2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103661184 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103661184
NCBI-ProteinID: XP_008687110
UniProt: A0A384BY78
LinkDB All DBs
Position
Un
AA seq 420 aa AA seqDB search
MDASDRGRLLNXDLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCFRYYAGWADKYH
GKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLAPALATGNVVVMKVAEQTPLT
ALYVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSS
NLKRVTLELGGKSPNIIMSDADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYSEFVE
RSVARAKSRVVGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYF
IQPTVFGDVQDSMTIAREEIFGPVMQILKFKTIEEVIGRANNSKYGLAAAIFTKDLDKAN
YLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatccgacaggggccgcctgctgaacnncgatctgattgagcgggaccggacc
tacctagcagccttggagaccctggataacggcaagccctatgtcatctcctacctggtg
gatctggacatggtcctcaaatgcttccgttattatgctggctgggctgataagtaccac
gggaaaaccattcccattgacggggacttcttcagctatacccgccatgaacccgtcggg
gtgtgcgggcagatcattccgtggaacttcccgctcctgatgcaagcctggaaactggcc
ccagccctggcgaccggaaacgtggttgtgatgaaggtagctgagcagactccactcacc
gccctctatgtggccaacctgattaaggaggctggctttccccctggagtggtcaatatt
attcctgggtttggccccacagctggggctgccatcgcctcccatgaggatgtggacaaa
gtggccttcacaggctccaccgaggttggccacctaatccaagttgctgcagggagcagt
aacctcaagagagtgaccctggagctgggtggaaagagccccaatatcatcatgtcagat
gcagacatgaactgggctgtggagcaggcccacttcgccctgttcttcaaccagggtcag
tgctgctgtgcgggctcccggacctttgtgcaagaagatgtgtactctgagtttgtggag
cggagtgttgcccgggccaagtctcgtgtagttgggaacccctttgatagccagactgag
caggggccgcaggtggacgaaactcagtttaagaaggtccttggttatatcaaatctggg
aaggaggagggggcgaagctgctgtgcggcggaggggcggctgctgaccgtggctacttc
atccagcccactgtgtttggagacgtgcaagacagcatgactatcgccagggaggagatc
tttgggccggtgatgcagattctgaagttcaaaaccatagaggaagtcattgggagagcc
aacaactccaagtatgggctggctgcagctatcttcaccaaggacttggacaaggccaat
tatctgtcccaagccctgcaggctggcactgtgtgggtcaactgctatgatgtgttcggg
gcccagtcaccgttcggtggctacaagatgtctgggagcggccgggagctaggagagtat
gggctgcaggcatacaccgaagtgaaaactgtcacggtcaaagtgcctcagaagaactcc
tga

DBGET integrated database retrieval system