KEGG   Ursus maritimus (polar bear): 103661697
Entry
103661697         CDS       T03271                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04110  Cell cycle
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04350  TGF-beta signaling pathway
umr04390  Hippo signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04630  JAK-STAT signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05132  Salmonella infection
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05216  Thyroid cancer
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661697 (MYC)
   04012 ErbB signaling pathway
    103661697 (MYC)
   04310 Wnt signaling pathway
    103661697 (MYC)
   04350 TGF-beta signaling pathway
    103661697 (MYC)
   04390 Hippo signaling pathway
    103661697 (MYC)
   04630 JAK-STAT signaling pathway
    103661697 (MYC)
   04151 PI3K-Akt signaling pathway
    103661697 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103661697 (MYC)
   04218 Cellular senescence
    103661697 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103661697 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103661697 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661697 (MYC)
   05202 Transcriptional misregulation in cancer
    103661697 (MYC)
   05206 MicroRNAs in cancer
    103661697 (MYC)
   05205 Proteoglycans in cancer
    103661697 (MYC)
   05230 Central carbon metabolism in cancer
    103661697 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103661697 (MYC)
   05225 Hepatocellular carcinoma
    103661697 (MYC)
   05226 Gastric cancer
    103661697 (MYC)
   05216 Thyroid cancer
    103661697 (MYC)
   05221 Acute myeloid leukemia
    103661697 (MYC)
   05220 Chronic myeloid leukemia
    103661697 (MYC)
   05219 Bladder cancer
    103661697 (MYC)
   05213 Endometrial cancer
    103661697 (MYC)
   05224 Breast cancer
    103661697 (MYC)
   05222 Small cell lung cancer
    103661697 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103661697 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103661697 (MYC)
   05161 Hepatitis B
    103661697 (MYC)
   05160 Hepatitis C
    103661697 (MYC)
   05163 Human cytomegalovirus infection
    103661697 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103661697 (MYC)
   05169 Epstein-Barr virus infection
    103661697 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103661697 (MYC)
   03019 Messenger RNA biogenesis [BR:umr03019]
    103661697 (MYC)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103661697 (MYC)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103661697 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 103661697
NCBI-ProteinID: XP_008687604
UniProt: A0A384BZF2
LinkDB
Position
Un
AA seq 262 aa
MGGEKAEGQRCIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEP
LALHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSSGSHSKPPHSPLVL
KRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRR
THNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQTEEQKLISEK
DLLRKRREQLKHKLEQLRNSGA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgggaggggagaaggcagagggacaacggtgcatcgacccgtccgtggtcttcccctac
ccgctcaacgacagcagctcgcccaagccctgcgcctccccggactccaccgccttctcc
ccgtcctcggactctctgctctcctcggccgagtcctccccgcgggccagccccgagccc
ctggcgctccacgaggagacaccgcccaccaccagcagcgactcggaggaagaacaagag
gacgaagaagaaattgatgttgtttctgtggaaaaaaggcagccccctgccaaaaggtca
gaatcggggtcaccgtcgtcgggaagccacagcaaaccacctcatagcccgctggtcctt
aaaagatgccatgtgtccacccatcagcacaattacgcagcgcccccctccaccaggaag
gactatccggccgccaagagggctaagttggacagtggcagggtcctgaaacaaatcagc
aacaaccgtaaatgcgccagccccaggtcttcggacacagaggagaacgacaagaggcgg
acacacaacgtcttagaacgccagaggagaaacgagctgaaacggagcttttttgccctg
cgtgaccagatcccggagttggaaaacaatgaaaaggcccccaaggttgtcatccttaaa
aaagccaccgcgtacatcctgtccgtccaaacagaggagcagaagctcatctcagaaaag
gacttgttgcggaagcggcgagaacagttgaaacacaaacttgaacagctaaggaactct
ggtgcctaa

DBGET integrated database retrieval system