KEGG   Ursus maritimus (polar bear): 103661704
Entry
103661704         CDS       T03271                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103661704 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103661704 (ADCY8)
   04371 Apelin signaling pathway
    103661704 (ADCY8)
   04020 Calcium signaling pathway
    103661704 (ADCY8)
   04072 Phospholipase D signaling pathway
    103661704 (ADCY8)
   04024 cAMP signaling pathway
    103661704 (ADCY8)
   04022 cGMP-PKG signaling pathway
    103661704 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103661704 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103661704 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103661704 (ADCY8)
   04062 Chemokine signaling pathway
    103661704 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    103661704 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    103661704 (ADCY8)
   04912 GnRH signaling pathway
    103661704 (ADCY8)
   04913 Ovarian steroidogenesis
    103661704 (ADCY8)
   04915 Estrogen signaling pathway
    103661704 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    103661704 (ADCY8)
   04921 Oxytocin signaling pathway
    103661704 (ADCY8)
   04926 Relaxin signaling pathway
    103661704 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    103661704 (ADCY8)
   04918 Thyroid hormone synthesis
    103661704 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    103661704 (ADCY8)
   04916 Melanogenesis
    103661704 (ADCY8)
   04925 Aldosterone synthesis and secretion
    103661704 (ADCY8)
   04927 Cortisol synthesis and secretion
    103661704 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103661704 (ADCY8)
   04270 Vascular smooth muscle contraction
    103661704 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    103661704 (ADCY8)
   04971 Gastric acid secretion
    103661704 (ADCY8)
   04972 Pancreatic secretion
    103661704 (ADCY8)
   04976 Bile secretion
    103661704 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    103661704 (ADCY8)
   04727 GABAergic synapse
    103661704 (ADCY8)
   04725 Cholinergic synapse
    103661704 (ADCY8)
   04720 Long-term potentiation
    103661704 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    103661704 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    103661704 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    103661704 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    103661704 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    103661704 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103661704 (ADCY8)
   04714 Thermogenesis
    103661704 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661704 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    103661704 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103661704 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103661704 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103661704 (ADCY8)
   05163 Human cytomegalovirus infection
    103661704 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103661704 (ADCY8)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103661704 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 103661704
NCBI-ProteinID: XP_008687606
UniProt: A0A384BYD8
LinkDB
Position
Un
AA seq 1127 aa
DLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVM
NVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTYLQYS
GVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLLQVV
LQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLET
ENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTN
LSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEM
GLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGI
PGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDIVKES
VSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPE
EINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVLLF
ITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINETYLAR
NVIIFASILINFLGAILNILWCDFDKSIPLKNLAFNSSAVFTDICSYPEYFVFTGVLAMV
TCAVFLRLNSVLKLAVLLIMTAIYALLTETIYAGLFLRYDNLNHSGETDFLGTKEASLLL
MAVFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFL
EKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGE
DRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNN
FELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQG
FAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLN
RQRQKQLLNEDNNTGIIKAHYNRRTLLAPSGPEPGAPAEGTDKSDLP
NT seq 3384 nt   +upstreamnt  +downstreamnt
gatctgggcttcctgcacctcgactgcgccccgagcaactcggatttcttcctcaatggg
ggctacagctaccgaggggtcattttccccactctgcgcaactccttcaagtcccgggat
ctggagcgcctctaccagcgctatttcctgggccagaggcgcaaatccgaggtggtgatg
aacgtgttggatgtgctgaccaaactcaccctcttggtcctgcacttgagcctggcctcg
gcccccatggacccgctcaagggcatcctcctgggcttcttcactggcatcgaggtggtg
atctgcgccctggtggtggtcaggaaggacaccacctcgcacacgtacctgcagtacagc
ggcgtggtcacttgggtggccatgaccacccagatcttggcagcaggcctcggctacggg
cttttgggtgatggcatcggctacgttctcttcacgctgttcgccacctacagcatgctg
ccgctgccgctcacctgggccatcctggccggcttgggcacctcgctgctgcaggtggtc
ctgcaggtggtcatcccccggctagcggtcatttccatcaaccaggtcgtggcccaggca
gtattattcatgtgtatgaacacagctggaatcttcatcagttacctgtcagaccgggcc
cagcgccaagccttcctggagacgcggaggtgtgtggaggccaggctccgcctggagacg
gaaaaccaaagacaggagcgtctcgtgctatctgtgctcccccgctttgtcgtcctggaa
atgatcaatgacatgaccaatgttgaagacgagcacttgcagcaccagttccatcggatc
tacatccatcgctatgagaacgtcagtattctttttgcagatgttaaaggatttaccaac
ctctccacaaccttgtccgcccaggagctggtccggatgctcaacgagctctttgccaga
tttgatcgactggcccatgagcatcactgccttcgcattaaaatcctgggggactgttac
tactgtgtttcagggcttcctgagccccgccaggaccacgcccactgctgtgttgaaatg
ggcctcagcatgatcaaaaccatcaggtatgtgaggtcgaggacgaagcatgatgtggac
atgcggatcggaatccactctggctcagtgctatgtggcgtgttgggcctgcggaagtgg
cagtttgatgtctggtcttgggatgtggacattgcaaacaaactcgaatctggaggaatc
cccgggaggattcacatttccaaagccacgctggactgcctcaacggcgactataacgtg
gaagagggtcatggtaaagagagaaacgaattcttgaggaagcataatattgagacctac
ttgattaagcagcctgaggaaagtctgctgtcgttgcccgaagacatcgtcaaggagtcg
gtgagctcctcagacaggagaaacagtggggcaacattcacagaaggatcctggagcccc
gaactgccctttgataacatagtggggaaacagaacactctggctgccctaacaagaaat
tcaataaatctacttccaaaccatcttgcacaagctttgcatgtccagtctgggcctgag
gaaattaacaagagaatagaacataccatcgacttgcggagtggcgataaattgagaaga
gagcatatcaagccattctcactgatgtttaaagactccagcctggagcacaagtattct
caaatgagggatgaagtattcaagtcaaacttggtctgtgcatttatcgttcttctattt
atcacggcgatacaaagtttgcttccttcctcaagggtgatgccaatggccatccagttt
tccatcctgattatgctgcactcggctctggtcctcatcaccacggcggaggattataag
tgtttgcccctcgtcctccggaaaacttgctgttggattaacgagacctatttggcccgg
aacgtcatcatctttgcatccatcttgattaacttcctgggcgccatcttgaatatcctg
tggtgtgattttgacaagtcgatacccttgaagaacctggctttcaattcctcagctgtg
tttacagatatctgctcctacccagagtacttcgtcttcaccggggtgctggccatggtg
acctgtgcggttttcctccgcctgaactctgtcctgaagctggccgtgctgctgattatg
accgccatctacgccctgctcaccgagaccatctacgcgggcctcttcctgcgctacgac
aacctgaaccacagtggagagacagatttcctggggaccaaggaggcgtcactgctcctg
atggccgtgttcctccttgccgtgttctaccatggacagcagctggagtatacagcccgc
cttgacttcctttggcgagtacaggccaaagaggagatcaacgagatgaaggagctgagg
gaacacaacgagaacatgctccggaacattctacccagccacgtggcccgccacttcctg
gagaaagaccgagacaacgaggagctgtattctcaatcctacgatgccgtcggggtgatg
tttgcctccatcccggggttcgcagacttctactctcagaccgaaatgaataaccaggga
gtggaatgcctgcgcctgctgaatgagatcatcgctgacttcgatgagctgctcggcgaa
gaccggtttcaagacattgaaaagattaagaccattggcagcacctacatggccgtgtca
ggcctgtcacccgaaaaacagcaatgcgaagacaagtggggacatttgtgcgccctggcc
gacttctccctcgccctgaccgagagcatacaggagatcaacaagcattccttcaacaat
ttcgaactccggatcggcatcagccacggctcggtggtagctggcgttatcggcgctaag
aaaccgcagtatgacatttggggcaaaaccgtgaacctggcaagtcgaatggacagcacg
ggggtcagcggcaggatccaagtccccgaggagacctatctcatcctgaaggaccagggc
tttgcctttgactaccgaggggagatctacgtgaagggcatcagtgaacaggaaggaaaa
atcaaaacatactttctgctgggaagagtccaacccaacccattcatcctgcccccgaga
agactgcccgggcagtactccctggccgcggtcgtcctgggccttgtccagtccctcaac
aggcaaaggcagaagcagctgcttaacgaggacaacaacacggggatcatcaaggctcat
tacaaccggcggactttgctggcacccagcgggccagagcccggagccccagccgaaggc
accgacaagtccgatttgccatga

KEGG   Ursus maritimus (polar bear): 103668547
Entry
103668547         CDS       T03271                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103668547 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103668547 (ADCY9)
   04371 Apelin signaling pathway
    103668547 (ADCY9)
   04020 Calcium signaling pathway
    103668547 (ADCY9)
   04072 Phospholipase D signaling pathway
    103668547 (ADCY9)
   04024 cAMP signaling pathway
    103668547 (ADCY9)
   04022 cGMP-PKG signaling pathway
    103668547 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103668547 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103668547 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103668547 (ADCY9)
   04062 Chemokine signaling pathway
    103668547 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    103668547 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    103668547 (ADCY9)
   04912 GnRH signaling pathway
    103668547 (ADCY9)
   04913 Ovarian steroidogenesis
    103668547 (ADCY9)
   04915 Estrogen signaling pathway
    103668547 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    103668547 (ADCY9)
   04921 Oxytocin signaling pathway
    103668547 (ADCY9)
   04926 Relaxin signaling pathway
    103668547 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    103668547 (ADCY9)
   04918 Thyroid hormone synthesis
    103668547 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    103668547 (ADCY9)
   04916 Melanogenesis
    103668547 (ADCY9)
   04925 Aldosterone synthesis and secretion
    103668547 (ADCY9)
   04927 Cortisol synthesis and secretion
    103668547 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103668547 (ADCY9)
   04270 Vascular smooth muscle contraction
    103668547 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    103668547 (ADCY9)
   04971 Gastric acid secretion
    103668547 (ADCY9)
   04972 Pancreatic secretion
    103668547 (ADCY9)
   04976 Bile secretion
    103668547 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103668547 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103668547 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    103668547 (ADCY9)
   04727 GABAergic synapse
    103668547 (ADCY9)
   04725 Cholinergic synapse
    103668547 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    103668547 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103668547 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    103668547 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    103668547 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103668547 (ADCY9)
   04714 Thermogenesis
    103668547 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668547 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    103668547 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103668547 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103668547 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103668547 (ADCY9)
   05163 Human cytomegalovirus infection
    103668547 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103668547 (ADCY9)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103668547 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 103668547
NCBI-ProteinID: XP_008695054
UniProt: A0A384CKP8
LinkDB
Position
Un
AA seq 1352 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHVRSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTLAAKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVVYSVLFETFGYHFRDKDCFPPPGAGAPHWELLSRALLHLCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSRVS
SGPRRQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQEEHKN
STKAPGAPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAATTAPPPAALAVFSAALLLEMLSLVVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHFTVFMGS
AVLITVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSIVISHLDAGQNFSSEG
NPCNSSLPRDGGTASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKI
QSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKEC
YRVLNELIGDFDELLSRPGYSSIEKIKTIGATYMAASGLNGAQCQDGSHPQEHLQVLFEF
AKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDSGAVPQHQLSISPD
IRVQVDGSIGRSPTDEIANLVPSVQNADKMSLGSENNVQAKDIHLSSKRPWKEPFKAEER
CRFGKAIEKSDCEEAGMEEASELTRLNVSKSV
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggcttccccaccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaattaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgtagcagctctggggactca
gggggtgtcccccggagagtgggcgctggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgatggtgggaccccaagttcgactccgtgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccgatatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttggggtccacgtgaggtcc
aaactgattgtcatggtagccccagctctgtgcttcctcgtagtgtgtgtgggctttttt
ctgtttaccttcaccaagctgtatgcccggcattacgtgtggacctctctggttctcacc
ctcctggtgttcgccctgaccctggctgcccagtttcaggttttgacgcctctctcagga
cgtgttgacagctccaatcataccctcgcagccaagcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttactctacacggtcatgcactta
cctttgtacttgagcttgtttttgggagtggtctattctgttctctttgagacctttggc
tatcatttccgagacaaagactgctttcccccacctggagcaggggcgccacactgggag
ttgctgagccgagccctgctccacctctgcattcatgccattgggatccacctatttatc
atgtcccaggtgagatctcggagcacctttctcaaggtgggacagtcaattatgcatgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccgaga
atcatagctgatgacctgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgcgacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctata
gcattccgccctttcaaaatgcagcagatagaagaagtcagtattttatttgcagatatc
gtgggcttcacaaagatgagtgccaataagtctgctcacgccctggtgggtctcctcaac
gatctgtttggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaattagtacc
ctgggagactgctactattgtgtggcggggtgtccggagccccgggccgaccatgcctac
tgctgcattgagatgggcttgggcatgatcagagctatcgagcaattctgccaggagaag
aaagagatggtgaacatgcgtgtcggggttcacacggggactgtcttgtgcggcattttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtggcgggcaaggttcacatttctgaggccacagcaaaatacctagat
gatcggtacgaaatggaagatgggaaagttactgaacgccttggccagagcgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgctcagaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggtcctaggagacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgtccttcatgcggaatcacgtttgcccccaaa
tcggaagctggtgcagaaggaggagcggtccaaaatggctgtcaagaggagcataaaaac
agcaccaaggctcctggagcaccgaattccaaaactcagaatggacttctgagccctccc
caagaggaaaagctcaccaacagtcagacctccctgtgtgagatcttacaggaaaaggga
aggtgggcaggagtgagcttggaccagtcagctctccttccgctgagattcaagaacatc
cgggagaaaacagatgcccattttgtcgatgttatcaaagaagacagcctgatgaaagat
tattttttcaagccacccatcaatcagttcagcttgaacttcctggatcaggagctagag
cgatcctataggaccagctaccaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgtttctttcgacgacagtgtttctaatt
ctctctatcacctgcttcctgaagtacggggctgccaccacggctcccccgcctgccgcc
ctggcagtcttcagcgccgccctgctgctggagatgctgagccttgtggtctccatcagg
atggtgtttttcctggaggatgtgatggcctgtacgaagcgcctgctggagtggatagcc
ggctggctcccgcgccatttcattggggccatcctggtgtcactccctgctcttgcagtc
tattcacatgtcacctctgaatttgagacaaacatacacttcaccgtgtttatgggctca
gccgtcctgatcaccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttagccacagtcgtcggggctgggcccctgctcctgctctatgtctccctgtgc
cctgacagttccatagtaatttcacaccttgatgcaggacagaatttcagttccgagggg
aatccgtgcaatagttccttgccacgtgatggcggaacggccagcctgattggccaggag
gtgattcttgtcttctttctcctgctcctgttggtctggttcctgaatcgagaattcgag
gtcagctaccgcctgcactaccatggggacgtggaggcggaccttcaccgcaccaagatc
cagagcatgagggaccaagctgactggctgctgagaaacatcatcccctaccacgtggcc
gagcagctgaaggtctcacagacctactccaagaaccacgacagcggaggcgtcatcttc
gccagcatcgtcaacttcagtgagttctacgaggagaactacgaggggggcaaggagtgc
taccgggtcctcaacgagctcatcggggacttcgacgagctcctgagcaggccgggctac
agcagcatcgagaagatcaagaccattggggccacgtacatggctgcatcgggtctgaac
ggcgcccagtgccaggacggcagccacccgcaggagcacctgcaggtcctgtttgagttc
gccaaggagatgatgcgtgtggtggacgacttcaacagcaacatgctgtggttcaacttt
aagctcagggtcggcttcaaccatgggccgctcacagcgggggtcatcggcaccaccaag
ctgctgtatgacatctggggcgacactgtcaacatcgccagcaggatggacagcacaggg
gtggagtgccgcatccaggtgagcgaggagagctaccgcgtcctgagcaagatgggctac
gacttcgactaccgggggacagtgaacgtgaagggcaagggccagatgaagacctacctg
tacccaaagtgcatggacagcggggccgtgccacagcaccagctgtccatctccccggac
atccgagtccaggtggacggcagcattgggcggtctcccacggatgagatcgccaacctg
gtgccttctgtacagaatgcagacaagatgtctctgggttccgaaaacaacgttcaggcc
aaggacattcacctgtcctctaagaggccgtggaaagagcccttcaaagccgaagaaagg
tgtcgatttggcaaagccatagagaaaagtgactgtgaagaagctggcatggaggaagcc
agcgagctcaccaggctcaatgtttccaagagcgtgtga

KEGG   Ursus maritimus (polar bear): 103671685
Entry
103671685         CDS       T03271                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04740  Olfactory transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103671685 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103671685 (ADCY3)
   04371 Apelin signaling pathway
    103671685 (ADCY3)
   04020 Calcium signaling pathway
    103671685 (ADCY3)
   04072 Phospholipase D signaling pathway
    103671685 (ADCY3)
   04024 cAMP signaling pathway
    103671685 (ADCY3)
   04022 cGMP-PKG signaling pathway
    103671685 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103671685 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103671685 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103671685 (ADCY3)
   04062 Chemokine signaling pathway
    103671685 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    103671685 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    103671685 (ADCY3)
   04912 GnRH signaling pathway
    103671685 (ADCY3)
   04913 Ovarian steroidogenesis
    103671685 (ADCY3)
   04915 Estrogen signaling pathway
    103671685 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    103671685 (ADCY3)
   04921 Oxytocin signaling pathway
    103671685 (ADCY3)
   04926 Relaxin signaling pathway
    103671685 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    103671685 (ADCY3)
   04918 Thyroid hormone synthesis
    103671685 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    103671685 (ADCY3)
   04916 Melanogenesis
    103671685 (ADCY3)
   04925 Aldosterone synthesis and secretion
    103671685 (ADCY3)
   04927 Cortisol synthesis and secretion
    103671685 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103671685 (ADCY3)
   04270 Vascular smooth muscle contraction
    103671685 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    103671685 (ADCY3)
   04971 Gastric acid secretion
    103671685 (ADCY3)
   04972 Pancreatic secretion
    103671685 (ADCY3)
   04976 Bile secretion
    103671685 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103671685 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103671685 (ADCY3)
   04727 GABAergic synapse
    103671685 (ADCY3)
   04725 Cholinergic synapse
    103671685 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    103671685 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    103671685 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    103671685 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    103671685 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    103671685 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103671685 (ADCY3)
   04714 Thermogenesis
    103671685 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671685 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    103671685 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103671685 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103671685 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103671685 (ADCY3)
   05163 Human cytomegalovirus infection
    103671685 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103671685 (ADCY3)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103671685 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N NCE101 fn3_4
Other DBs
NCBI-GeneID: 103671685
NCBI-ProteinID: XP_008698591
UniProt: A0A384CUW6
LinkDB
Position
Un
AA seq 1134 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCTVVFSSDKLAPLLVAGMGLLLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHSASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGMHLLREILANVSLYLCAVAVG
VMSYYMADRKHRKAFLEAREEQSQQQENLMLSILPKHVADEMLKDMKKDESQKDQQQFNT
MYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQLRIKILGDC
YYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKR
WQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCEYLDEKGIET
YLIIASKPEVKKTAAQHGLGGRVSPPPAPDRPREGAVSENQELPGQAHAXGSTSEEPEEQ
ETQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLL
SMRFMDPDMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYMTFVVGEVLL
LILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYY
TGPTNSTAGLEVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVAVIN
IYAWRPIFDEYDRKRFQEHDFPAVALEKMQGFSTPGLNGTGRLPLVPSKYSMTAMILVMM
LSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKR
DEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRV
ITKIKTIGSTYMAASGVTPDVNTNGFASSNKEEKSDKERWQHLADLADFALAMKDTLTNI
NNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQ
AILREYGFRFVRRGTIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQVVDNS
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcctgagtactcggccgagtactccgccgagtac
tcggtcagcctgccctctgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggatcctgcctctgcctgcctcggttcatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttcaaacggcagcgccatgagaccctgctggtg
ctggtggtgttcgctgcgctcttcgactgctatgtggtggtcatgtgcacggtggtcttc
tccagcgacaagctggctcccctcctcgtagctgggatgggactgctgttggacatcctc
ctcttcgtactctgcaaaaaggggctgctcccggaccgggtcacccggaaagtggtgccc
tacctgctgtggctactgataactgcccagattttctcttacctgggcctgaactttgcc
cgagcccactcggccagtgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgccgctcagcctcagccccatcgtcatcatctctgtggtctcctgcgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaagggcatg
cacttgctgagggagatcctggcgaacgtctccctctacctgtgcgccgtcgccgtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgcgag
gagcagagccagcagcaggagaaccttatgctctccatcctgcccaagcacgtggctgac
gagatgctgaaggacatgaagaaggacgagagccagaaggaccagcagcagttcaacacc
atgtacatgtaccggcacgagaacgtcagcatcctctttgcggacatcgtgggcttcacc
cagctgtcttctgcctgcagtgcccaggagctcgtgaagctgctcaacgagctctttgcc
cgcttcgacaagctggcagccaaataccaccagctgcggattaagatcctaggcgactgt
tactactgcatctgcggcctgcccgactaccgggaggaccacgccgtctgctccatcctc
atggggctcgccatggtggaggccatctcgtacgtgcgggagaagacgaagactggggtg
gacatgcgcgtgggggtgcacacgggcaccgtgctggggggcgtcctgggccagaaacgc
tggcagtacgacgtgtggtctaccgacgtcactgtggccaacaagatggaggccggaggc
atccccgggcgtgtgcacatctcccagagcaccctggactgcctgaagggcgagttcgat
gtggagccgggcgacgggggcagccgctgtgagtacctggacgagaagggcatcgagacc
tacctcatcatcgcgtccaagccagaggtgaagaagacagccgcccagcacggcctcggt
ggccgggtgagtcccccgcccgccccggacaggccacgggaaggggctgtctcagaaaat
caggaactgccaggccaggcccacgcnnncggctccacatcggaggagcccgaggagcag
gagacccaggccgacaacccctcgttccccaacccgcgccggaggctgcgccttcaggac
ctggctgaccgagtggtggacgcctccgaggatgagcacgagctcaaccagctactcaac
gaggccctgctggagcgagagtccgcccaggtggtgaagaagagaaacaccttcctcctt
tccatgcggttcatggaccccgacatggaaacccgctactcagtggagaaggaaaagcag
agcggggctgccttcagctgctcctgcgtcgtcctgctctgtacggccctggtcgagata
ctcatcgacccctggctaatgacaaactacatgacctttgtggttggggaggttctgctt
ctgatcctgacaatctgctcgctggccgccatctttccccgggcctttcctaagaagctc
gtggccttctccacttggatcgaccggacccgctgggccaggaacacctgggccatgtta
gccatcttcattctggttatggcaaatgtcgtggacatgctcagctgtctccagtactac
acaggcccaaccaacagcactgcagggctggaggtggaagacggctgcgtcgagaacccc
aagtattacaactatgtcgccgtgctgtccctcatcgccaccatcatgctggtgcaggtc
agccacatggtgaagctcacactcatgctgctcgtcaccggggctgtggccgtcatcaac
atctatgcctggcgccccatctttgatgaatacgaccgcaaacgttttcaggaacatgac
ttccctgcagtcgccttagagaagatgcagggattttccacccctgggctcaatggcacc
ggcaggctgcccctggtaccttctaagtactccatgaccgcgatgatcctcgtcatgatg
ctgagcttctactacttctcacgccacgtggaaaaattggcaaggacactgttcttgtgg
aagattgaggtccatgaccagaaggaacgggtctacgagatgcggcgctggaacgaggcc
ttggtcaccaacatgttgcctgagcacgtggcacgccatttcctggggtccaagaagaga
gatgaggagctgtacagccagtcttacgatgagatcggagtcatgtttgcctccctgccc
aacttcgccgacttctacacggaggagagcatcaacaacggcggcattgagtgtctgcgc
ttcctcaacgagatcatctccgactttgattctctcctggacaatcccaagttccgggtc
atcaccaagatcaaaaccattggcagcacctacatggccgcttccggagtcaccccagat
gtcaacaccaacggctttgccagctccaacaaggaggagaagtcagacaaggagcgctgg
cagcacctggctgatctggccgacttcgctctggccatgaaggatacgctcacaaacatc
aacaaccagtccttcaacaacttcatgctgcgcatcggcatgaacaaaggaggggtcctg
gctggggtcattggagcccggaaaccacactatgacatctggggcaacacagtcaatgtg
gccagcaggatggagtccacaggggtcatgggcaacattcaggtggtggaagaaacacaa
gccatccttcgagagtacggcttccgctttgtgaggcgagggacaatctttgtgaaaggg
aaaggggagctgctaacctttttcttgaaggggcgtgataagccagctgccttcccaaat
ggctcctcggtcaccctgccccaccaggtggtggacaactcctga

KEGG   Ursus maritimus (polar bear): 103673916
Entry
103673916         CDS       T03271                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103673916 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103673916 (ADCY7)
   04371 Apelin signaling pathway
    103673916 (ADCY7)
   04020 Calcium signaling pathway
    103673916 (ADCY7)
   04072 Phospholipase D signaling pathway
    103673916 (ADCY7)
   04024 cAMP signaling pathway
    103673916 (ADCY7)
   04022 cGMP-PKG signaling pathway
    103673916 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103673916 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103673916 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103673916 (ADCY7)
   04062 Chemokine signaling pathway
    103673916 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    103673916 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    103673916 (ADCY7)
   04912 GnRH signaling pathway
    103673916 (ADCY7)
   04913 Ovarian steroidogenesis
    103673916 (ADCY7)
   04915 Estrogen signaling pathway
    103673916 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    103673916 (ADCY7)
   04921 Oxytocin signaling pathway
    103673916 (ADCY7)
   04926 Relaxin signaling pathway
    103673916 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    103673916 (ADCY7)
   04918 Thyroid hormone synthesis
    103673916 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    103673916 (ADCY7)
   04916 Melanogenesis
    103673916 (ADCY7)
   04925 Aldosterone synthesis and secretion
    103673916 (ADCY7)
   04927 Cortisol synthesis and secretion
    103673916 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103673916 (ADCY7)
   04270 Vascular smooth muscle contraction
    103673916 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    103673916 (ADCY7)
   04971 Gastric acid secretion
    103673916 (ADCY7)
   04972 Pancreatic secretion
    103673916 (ADCY7)
   04976 Bile secretion
    103673916 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    103673916 (ADCY7)
   04727 GABAergic synapse
    103673916 (ADCY7)
   04725 Cholinergic synapse
    103673916 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    103673916 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103673916 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    103673916 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    103673916 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103673916 (ADCY7)
   04714 Thermogenesis
    103673916 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673916 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    103673916 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103673916 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103673916 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103673916 (ADCY7)
   05163 Human cytomegalovirus infection
    103673916 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103673916 (ADCY7)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103673916 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 103673916
NCBI-ProteinID: XP_008700992
UniProt: A0A384D1P9
LinkDB
Position
Un
AA seq 1092 aa
MPAKGRYFLNEGEEGPDQTALYEKYRLTSQHGPLLLTLLLVAVAACVALIVITFVCGDPS
RHQAVLGTAFFTLAVFVALYVLVYVECLVRRWLRAMALFVWVCLMMLGYMLVFDSWMKAT
HMGAQVPFFLFIVFVAYTLLPFSMQGAVVAGVVSSLSHLLVLGVLMKAFTTPSVKVGLQL
LANAAIFLCGNLTGAFHKHQMQDASRDLFIYTVKCIQIRRKLRIEKRQQGTGSDPIDCSP
KELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEA
IKQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMDRVHITEATLNH
LDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPKPKGDAALKMRASVR
MTRYLESWGAARPFAHLNHRESMSSGETPVPSGRRPKTIPLRRHRTPDRNASPKGRSEDD
SYDEEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKDFEREVRVPQQPEERGLQARGGVR
VQATGWPTVPQPGWLGVMSGAAGARFSEIPFAARRWQSGREGGGRGPENWDAGGWGAHLQ
LGPGQVVPQNQGFLLSRMAALGVSFGLVACVLGLVLGLCFAREFPVSERPLTGHLARPRP
AGPLRPSCPGDSSRIPVSCPRAASGVALRRALWAGSPLMPLWALGLPAGNQTSPSPSPRA
GRSRELTLCELFPYYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFNISPCWQS
GCCGHTVANLTETNGTLSSSFCMWKDPKAMINFYLVLFYVTLLMLSRQIDYYCRLDCLWK
TKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDF
KVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSSVEKIKTIGSTYMAAAGLSSPSG
AENQDLERQHAHIGIMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQ
YDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVC
TDTAKFQGLGLN
NT seq 3279 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgctatttcctcaacgagggcgaagagggccctgaccagacggcg
ctctacgagaagtaccgcctcaccagccagcacgggccgctgctgctcacgctcctgctg
gtggccgtcgccgcctgcgtcgccctcatcgtcatcaccttcgtctgtggggacccctcc
agacaccaggctgtcctggggacggccttcttcacgcttgccgtgtttgtggctctctac
gtgctggtgtatgttgaatgcctcgtccggaggtggctcagggccatggcactgtttgtc
tgggtctgcctcatgatgctgggctacatgctggtgttcgactcctggatgaaggccacc
catatgggggcgcaggtgcccttcttcctgttcatcgtcttcgtggcatacacgctgctg
cccttcagcatgcagggggctgtcgtggccggggtggtctccagcctctcccacctcctg
gtgctcggagttctgatgaaggccttcacgacgcccagtgtcaaggtgggactgcagctg
ctggccaacgctgccatcttcctgtgcgggaacctcacgggcgccttccacaagcaccag
atgcaggatgcctctcgagacctcttcatctacaccgtcaagtgcatccagatccgtcgt
aagctgcgtatcgagaagcgccagcaggggacgggatcagatccgattgactgctccccg
aaagagctggtggtggtgctgaacgagctcttcggcaagtttgaccagatcgccaaggcc
aatgagtgtatgcggatcaagatcctgggggactgctactactgcgtgtcgggtctgccc
gtatccctgcccacccatgcccggaactgcgtgaagatgggcctggacatgtgtgaggcc
attaagcaggtgcgagaggccacgggtgtggacatcagcatgcgtgtgggcatacactca
gggaacgtgctgtgtggggtcattgggttgcgcaagtggcagtacgacgtgtggtcccac
gatgtgtccctggccaacaggatggaccgggtgcatatcacggaggcgacgttgaaccac
ctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgggacccctacctgaaa
gaaatgaacatccgtacctacctggtcatcgacccccggagccagcagccgcccccgccc
agccagcacctccccaagcccaagggggatgcggccctgaaaatgcgggcgtccgtgcga
atgacccgctacctcgagtcctggggggccgcgcggccctttgcgcacctcaaccaccgt
gagagcatgagcagtggcgagacccctgtccccagcgggcggaggcccaagaccattccc
ctgcggcgccaccgcacccctgacaggaacgcgtcccccaaggggcggtcggaggacgac
tcatacgatgaggagatgctgtcagccatcgaggggctgagctccacgaggccctgctgc
tccaagtctgatgacttctacacctttgggtctatcttcctggagaaggacttcgagcga
gaggtgagggtcccccagcagcccgaggaacgggggctccaggcccggggtggggtgcgg
gtgcaggccacggggtggcccacagtcccacagcccggctggctaggggtcatgagcggg
gcagccggagcacggttctcagagatcccctttgctgcgcgtagatggcagtctgggcgg
gaaggaggcggccgggggcccgagaattgggatgctgggggttggggagcacacctgcag
cttggccctgggcaggtggtcccccagaaccagggttttctgctttccaggatggcggct
ctgggtgtgtcctttgggctggtggcctgtgtgctggggctggtgctgggcctgtgcttt
gcccgtgagttcccggtgagtgagaggcccctgaccgggcacctggccaggccccgcccc
gctggccctctgcgcccctcctgcccgggcgatagttctcgaatcccggtctcctgcccg
agagctgcctctggtgtagctctccgcagggccctgtgggcaggctccccgctgatgcct
ctctgggccctggggctgcctgcgggcaaccagacgagcccgagcccgagcccgagggct
gggagaagcagggagctgacgctgtgcgagctcttcccgtattacacctgtagctgcatc
ctggccttcatcgcttgctcggtcttcctgcggatgagcctggagctgaaggtcgtgctg
ttgaccgtggctttggtagcttacctggtgctcttcaatatctccccgtgctggcagtcg
ggctgctgtggccacactgtggccaacctcactgagaccaacggcaccctcagctcctcg
ttctgcatgtggaaggacccgaaggccatgatcaatttctacctggttctgttttacgtc
accctgctcatgctctccagacagattgactactactgccgcctggactgtttatggaag
acgaagttcaagaaggaacacgaggagtttgagaccatggagaatgtgaaccgccttctt
ctggagaatgtcttgccagcccacgtggccgctcacttcattggcgacaagttaaatgag
gactggtaccatcagtcctacgactgcgtgtgtgtcatgttcgcgtctgtgccggacttc
aaagtcttctacacggagtgcgatgtcaacaaggaggggctggagtgtctgcggctgctg
aacgagatcatcgccgacttcgacgagctgctcctgaagcccaagttcagcagcgtggag
aagatcaagaccatcggcagcacatacatggcagccgcagggctcagcagcccctcaggg
gcggagaaccaggacctggagcgacagcacgcgcacattggcatcatggtggagttcagc
atcgccctgatgagcaagctggacggcatcaaccggcactcgttcaactccttccgcctc
cgagttggcataaaccacgggcccgtgattgctggagtgattggagcacgaaagcctcag
tatgacatctggggaaacacggttaacgtcgccagcaggatggagagcactggagaactt
ggcaagatccaggttactgaggagacatgcaccatcctccagggcctaggttattcttgc
gaatgccggggactgatcaacgtcaaaggcaaaggcgagctgaggacttactttgtctgt
acagacactgccaagttccaggggctggggctgaactga

KEGG   Ursus maritimus (polar bear): 103675618
Entry
103675618         CDS       T03271                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103675618 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103675618 (ADCY6)
   04371 Apelin signaling pathway
    103675618 (ADCY6)
   04072 Phospholipase D signaling pathway
    103675618 (ADCY6)
   04024 cAMP signaling pathway
    103675618 (ADCY6)
   04022 cGMP-PKG signaling pathway
    103675618 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103675618 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103675618 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103675618 (ADCY6)
   04062 Chemokine signaling pathway
    103675618 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    103675618 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    103675618 (ADCY6)
   04912 GnRH signaling pathway
    103675618 (ADCY6)
   04913 Ovarian steroidogenesis
    103675618 (ADCY6)
   04915 Estrogen signaling pathway
    103675618 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    103675618 (ADCY6)
   04921 Oxytocin signaling pathway
    103675618 (ADCY6)
   04926 Relaxin signaling pathway
    103675618 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    103675618 (ADCY6)
   04918 Thyroid hormone synthesis
    103675618 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    103675618 (ADCY6)
   04916 Melanogenesis
    103675618 (ADCY6)
   04924 Renin secretion
    103675618 (ADCY6)
   04925 Aldosterone synthesis and secretion
    103675618 (ADCY6)
   04927 Cortisol synthesis and secretion
    103675618 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103675618 (ADCY6)
   04270 Vascular smooth muscle contraction
    103675618 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    103675618 (ADCY6)
   04971 Gastric acid secretion
    103675618 (ADCY6)
   04972 Pancreatic secretion
    103675618 (ADCY6)
   04976 Bile secretion
    103675618 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103675618 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103675618 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    103675618 (ADCY6)
   04727 GABAergic synapse
    103675618 (ADCY6)
   04725 Cholinergic synapse
    103675618 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    103675618 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    103675618 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    103675618 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    103675618 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    103675618 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103675618 (ADCY6)
   04714 Thermogenesis
    103675618 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675618 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    103675618 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103675618 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103675618 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103675618 (ADCY6)
   05163 Human cytomegalovirus infection
    103675618 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103675618 (ADCY6)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103675618 (ADCY6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103675618
NCBI-ProteinID: XP_008702957
UniProt: A0A384D7A3
LinkDB
Position
Un
AA seq 913 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRPGGFCTPRYMSCLRDAQPPSPTPAAPP
RCPWQDEAFIRRGGPGNYGTGLWSWITLLGKEELGGGASLHPSTFSLAGQGWLGANVLLF
LCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKE
DINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAA
ENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISSISGEGNGSFFSLCSLG
PRQRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGAQ
DALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKADPRFGAYVAC
ALLVFCFICFIQLLVFPHSTLMLGTYAGIFLLLLTAVLTCAVSSCGSLFPKALRRLSRSI
VRSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPADITACHLQQLNYS
LGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAVIFVLGLVYLVLLLL
GPPATVFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQ
VESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSC
ECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGS
TYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAG
VIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKG
EMTTYFLNGGPPS
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggt
gagcgcaatgggcagaagcgtccacgccgtgggactcggcccgggggcttctgcacgcct
cgctacatgagctgcctccgggatgcgcagccccccagtcccacccctgcagctccgcct
cggtgcccctggcaggatgaggccttcatccggaggggcggcccgggtaactatggcact
gggctttggagttggattaccctcctggggaaggaggagcttggaggtggtgcctccctt
cacccctccaccttctctctggctggccaggggtggctgggtgccaacgtgctgctgttc
ctctgcaccaacgtcatcggcatctgcacgcactacccggcggaggtgtctcagcgccag
gcctttcaggagacccgcggttacatccaggcccggctgcacctgcagcatgagaatcgg
cagcaggaacggctgctgctgtccgtgttgccccagcatgttgccatggagatgaaagaa
gatatcaacacaaagaaagaagacatgatgttccacaagatctatatccagaagcatgac
aatgtcagcatcctgtttgcagacatcgaaggcttcaccagcctggcatcccagtgcacc
gcgcaggagctggtcatgaccctgaacgagctctttgcccggtttgacaagctggctgcg
gaaaatcactgcctgagaatcaagatcttaggggactgttactactgtgtgtcggggctg
ccggaggcccgggcagaccatgcccactgctgtgtggagatgggggtggacatgatcgag
gccatctcatccatcagcggggaggggaatggatctttcttcagcctgtgcagcttaggc
ccccgccagaggaaagaggagaaggccatgctggccaagctgcagcggacgcgggccaac
tccatggaagggctgatgccgcgctgggtgcccgaccgcgccttctcccggaccaaggac
tccaaggctttccgccagatgggcattgatgattccagcaaagacaaccggggtgcccaa
gatgccctgaaccccgaggatgaagtagatgagttcctgggccgtgccatcgatgcccgc
agcatcgatcagctacggaaggaccacgtgcgccgcttcctgctcaccttccagagagaa
gatcttgaaaagaagtactcgcggaaggcggacccccgcttcggagcctacgtggcctgc
gcgctgttggtcttctgcttcatctgctttatccagctcctcgtcttcccacactccacc
ctgatgcttgggacctatgccggtatcttcctgctgttgctgaccgccgtgctgacctgt
gccgtgtcctcctgtggctccctcttccccaaggccctgcgacgcctttcccgcagcatt
gtccgctctcgggcgcacagcactgtggttggcatcttttcagtcttgcttgtgttcacc
tctgccattgccaacatgttcacctgtaaccacacccccatacggacctgcgcagcccgg
atgctgaatgtgacgcccgcggacatcacagcctgccacctgcagcagctcaattactcc
ctgggcctggatgctccgctgtgtgagggcaccgcacccacttgcagcttccccgagtac
ttcgttgggaacatgctgctgagtctcctggccagctctgtcttcctgcacatcagcagc
atcgggaagttggccgtgatctttgtcctggggctcgtctatttggtgctgcttctgctg
ggccccccagccaccgtctttgacaactatgacctgctgcttggtgtccatggcttggct
tcttccaatgagactttcgacgggctggactgcccagctgcagggagggtggcgctcaaa
tacatgacccccgtgattctgctggtgtttgcactggcgttgtatctgcacgcccagcag
gtggagtcaactgcacgcctggacttcctctggaaactgcaggcaacaggggagaaggag
gagatggaggaactccaggcctacaaccgaagactgctgcataacattctgcccaaggac
gtggctgcccacttcctggcccgggagcgccggaatgacgagctctactatcagtcgtgt
gagtgtgtggccgtcatgtttgcctccattgccaacttttctgagttctatgtggagctg
gaggccaacaacgagggcgttgagtgtctgcggttgctcaacgagatcatcgctgacttc
gacgagatcatcagcgaggagcggttccggcagctggagaagatcaaaacgattggtagc
acctacatggctgcctcggggctgaacgccagcacctatgatcaggccggccgctcccac
atcactgccctggccgactatgccatgcggctcatggagcagatgaaacacatcaatgag
cactccttcaacaatttccagatgaagattgggctgaacatgggcccagtcgtggcaggt
gtcattggggctcggaagccgcagtatgacatctgggggaacacagtgaatgtctctagc
cgtatggacagcacaggggtccctgaccgaatccaggtgaccacggacttgtaccaggtt
ctagctgccaaaggctaccagctggagtgtcgaggggtggtcaaggtgaagggcaagggg
gagatgaccacctacttcctcaatgggggcccccccagttag

KEGG   Ursus maritimus (polar bear): 103678826
Entry
103678826         CDS       T03271                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103678826 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103678826 (ADCY5)
   04371 Apelin signaling pathway
    103678826 (ADCY5)
   04072 Phospholipase D signaling pathway
    103678826 (ADCY5)
   04024 cAMP signaling pathway
    103678826 (ADCY5)
   04022 cGMP-PKG signaling pathway
    103678826 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103678826 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103678826 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103678826 (ADCY5)
   04062 Chemokine signaling pathway
    103678826 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    103678826 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    103678826 (ADCY5)
   04912 GnRH signaling pathway
    103678826 (ADCY5)
   04913 Ovarian steroidogenesis
    103678826 (ADCY5)
   04915 Estrogen signaling pathway
    103678826 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    103678826 (ADCY5)
   04921 Oxytocin signaling pathway
    103678826 (ADCY5)
   04926 Relaxin signaling pathway
    103678826 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    103678826 (ADCY5)
   04918 Thyroid hormone synthesis
    103678826 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    103678826 (ADCY5)
   04916 Melanogenesis
    103678826 (ADCY5)
   04924 Renin secretion
    103678826 (ADCY5)
   04925 Aldosterone synthesis and secretion
    103678826 (ADCY5)
   04927 Cortisol synthesis and secretion
    103678826 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103678826 (ADCY5)
   04270 Vascular smooth muscle contraction
    103678826 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    103678826 (ADCY5)
   04971 Gastric acid secretion
    103678826 (ADCY5)
   04972 Pancreatic secretion
    103678826 (ADCY5)
   04976 Bile secretion
    103678826 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    103678826 (ADCY5)
   04727 GABAergic synapse
    103678826 (ADCY5)
   04725 Cholinergic synapse
    103678826 (ADCY5)
   04728 Dopaminergic synapse
    103678826 (ADCY5)
   04726 Serotonergic synapse
    103678826 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    103678826 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103678826 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    103678826 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    103678826 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103678826 (ADCY5)
   04714 Thermogenesis
    103678826 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103678826 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103678826 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    103678826 (ADCY5)
   05031 Amphetamine addiction
    103678826 (ADCY5)
   05032 Morphine addiction
    103678826 (ADCY5)
   05034 Alcoholism
    103678826 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103678826 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103678826 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103678826 (ADCY5)
   05163 Human cytomegalovirus infection
    103678826 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103678826 (ADCY5)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103678826 (ADCY5)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103678826
NCBI-ProteinID: XP_008706469
UniProt: A0A384DI42
LinkDB
Position
Un
AA seq 971 aa
AAFHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAA
VLSGVLLSALHLAIALRTNARDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQE
TRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSI
LFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEAR
ADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVT
LANHMEAGGKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRK
EEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESA
NPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASL
VFLFICFVQITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPGPLQTLSRKIVRS
KMNSTLVGVFTITLVFLSAFVNMFTCNSNDLFGCLADEHNISTSQVNACHVVESAANYSL
GDERGFCSSPWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLIVEVP
RVTLFDNADLLVTANAIDFNNNGTSQCPEHATKVALKVMTPIVISVFVLALYLHAQQVES
TARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECV
AVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFKQLEKIKTIGSTYM
AASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIG
ARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMM
TYFLNGGPPLS
NT seq 2916 nt   +upstreamnt  +downstreamnt
gccgccttccaccaggaccacatgggcctggcctgctacgcgctcatcgccgtggtgctg
gccgtccaggtggtgggcctgctgctgccccagccgcgcagcgcctccgagggcatctgg
tggaccgtgttcttcatctacaccatctacacgttgctgcctgtgcgcatgcgggccgcg
gtactcagtggagtgctcctttctgcactccacctggccatcgccctgcgcaccaacgcc
cgggaccagttcctgctcaagcagcttgtctccaatgtcctcattttctcctgcaccaac
attgtgggtgtttgcacccactacccggctgaagtctcccagagacaggccttccaggag
acccgggagtgcatccaggcacggctccactcacaacgggagaaccagcaacaggagcgg
ctcctgctgtctgtcctgccccgtcatgttgccatggagatgaaagcagacatcaatgcc
aagcaggaggatatgatgttccataagatttacatccagaaacacgacaacgtgagcatc
ctgtttgctgacatcgagggcttcaccagcctggcatcccagtgcactgcccaggagctg
gtcatgaccctcaacgagctcttcgcccgcttcgacaagctggctgcggagaatcactgt
ttacgtattaagatcctgggggattgttattactgtgtctctgggctgcctgaagcgagg
gctgaccacgcccactgctgcgtggagatgggcatggacatgattgaggccatctcgttg
gtccgggaggtgacaggggtgaacgtgaacatgcgcgtgggaattcacagcgggcgagta
cactgcggtgtccttggtctcaggaagtggcaattcgacgtctggtctaatgacgtcacg
ctggccaaccacatggaagctggaggcaaggcagggcgcatccacatcaccaaggccaca
ctcaactacctgaacggggactacgaggtggagccgggctgtgggggcgagcgtaacgcc
tacctcaaggaacacagtatcgagaccttcctcatcctgcgctgcacccagaagcggaaa
gaagaaaaggccatgatcgccaagatgaatcgccagagaaccaactccattgggcacaac
ccgccccactggggggccgagcgtcccttctacaaccacctggggggcaaccaggtgtcc
aaggagatgaagcggatgggcttcgaagaccccaaggacaagaacgcccaagaaagcgca
aaccctgaggacgaagtggacgaatttctgggccgtgccattgacgccaggagcatcgac
aggctgcggtctgagcatgtccgcaagttcctcttgaccttcagggagcctgacttagag
aagaagtactccaagcaggtggatgaccgattcggtgcctacgtggcatgtgcctcgctt
gtcttcctcttcatctgctttgtccagatcaccatcgtgccccactccgtgttcatgttg
agtttctacctaacctgtttcctgctgctgacgttagtggtatttgtgtccgtgatctat
tcctgcgtgaagctgttccccggcccactgcagaccctctccaggaagattgtgcggtcc
aagatgaacagcactctggttggcgtgttcaccatcaccctcgtgttcctctcggctttt
gtcaacatgttcacgtgtaactccaacgacctgttcggctgcctggcggatgagcacaac
atcagcaccagccaggtcaacgcgtgccacgtggtggagtcggccgccaactacagcctg
ggggacgagcggggcttctgcagcagcccgtggcccaactgcaacttccctgagtacttc
acctacagcgtgctgctcagcctgctggcctgctccgtgttcctgcagatcagctgcatt
gggaagctggtgctcatgctggccattgagctcacatacgtgctcatcgtcgaggtgccc
cgagtcacgctctttgacaatgccgacctgctggttaccgccaatgccatagacttcaac
aacaacgggacctcccagtgccctgagcatgcgaccaaggtggcgctgaaggtgatgacg
cccatcgtcatctccgtctttgtgctggccctgtacctgcacgcccagcaagtggagtcc
accgcccgcctggacttcctctggaaactgcaggccacggaggagaaggaggagatggag
gagctgcaggcctacaaccggcggctgctgcacaacatcctgcccaaggacgtggctgcc
cacttcctggcccgcgagcggcgcaacgacgagctctactaccagtcgtgcgagtgcgtg
gccgtcatgtttgcctccatcgccaacttctccgagttctatgtggagctggaggccaac
aatgagggcgtcgagtgcctgcggctgctcaatgagatcatcgccgactttgacgagatc
atcagtgaggatcggttcaagcagctggagaagatcaagaccattggcagcacctacatg
gccgcctcaggcctcaacgactctacgtatgacaaggtgggcaagacccacatcaaagcc
ctggccgacttcgccatgaagctcatggaccaaatgaagtacatcaatgaacactccttc
aacaacttccagatgaagatcgggctcaacatcggccctgtggtggccggggtgatcggg
gctcgcaagccgcagtacgacatctggggcaatacggtgaacgtggccagccgcatggac
agcaccggtgtgcccgaccgcatccaggtcaccacggacatgtaccaggtgctggctgcc
aacacataccagctggagtgcaggggtgtggtcaaggtcaagggcaaaggcgagatgatg
acctacttcctcaacgggggccccccgctcagttag

KEGG   Ursus maritimus (polar bear): 103679250
Entry
103679250         CDS       T03271                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103679250 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103679250 (ADCY2)
   04371 Apelin signaling pathway
    103679250 (ADCY2)
   04020 Calcium signaling pathway
    103679250 (ADCY2)
   04072 Phospholipase D signaling pathway
    103679250 (ADCY2)
   04024 cAMP signaling pathway
    103679250 (ADCY2)
   04022 cGMP-PKG signaling pathway
    103679250 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103679250 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103679250 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103679250 (ADCY2)
   04062 Chemokine signaling pathway
    103679250 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    103679250 (ADCY2)
   04922 Glucagon signaling pathway
    103679250 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    103679250 (ADCY2)
   04912 GnRH signaling pathway
    103679250 (ADCY2)
   04913 Ovarian steroidogenesis
    103679250 (ADCY2)
   04915 Estrogen signaling pathway
    103679250 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    103679250 (ADCY2)
   04921 Oxytocin signaling pathway
    103679250 (ADCY2)
   04926 Relaxin signaling pathway
    103679250 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    103679250 (ADCY2)
   04918 Thyroid hormone synthesis
    103679250 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    103679250 (ADCY2)
   04916 Melanogenesis
    103679250 (ADCY2)
   04925 Aldosterone synthesis and secretion
    103679250 (ADCY2)
   04927 Cortisol synthesis and secretion
    103679250 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103679250 (ADCY2)
   04270 Vascular smooth muscle contraction
    103679250 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    103679250 (ADCY2)
   04971 Gastric acid secretion
    103679250 (ADCY2)
   04972 Pancreatic secretion
    103679250 (ADCY2)
   04976 Bile secretion
    103679250 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103679250 (ADCY2)
   04727 GABAergic synapse
    103679250 (ADCY2)
   04725 Cholinergic synapse
    103679250 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    103679250 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103679250 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    103679250 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    103679250 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103679250 (ADCY2)
   04714 Thermogenesis
    103679250 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679250 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    103679250 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103679250 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103679250 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679250 (ADCY2)
   05163 Human cytomegalovirus infection
    103679250 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103679250 (ADCY2)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103679250 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 103679250
NCBI-ProteinID: XP_008706979
UniProt: A0A384DJN7
LinkDB
Position
Un
AA seq 1028 aa
MGVVFLLWDVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSVVIWICLVAMGY
LFLCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPG
AKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQER
LLLSLLPAHIAMEMKAEIIRRLQGPRAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRL
ASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMG
LDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVP
GRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPHLFRPRHTL
DGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTK
SQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALPAFKYY
VTCACLIFFCVFIVQILVLPKTSILGISFGAAFLLLAFILFICFAGQLLQCSKKASASLL
WLLKSSGIIADRPWPRVSLTVLTTAIILTMAVFNMFFLSDPEETIPPTANSSNTSLSALS
NQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAH
VLDDYSQVLFQRPGIWKDLKTMGSVSLFIFFVTLLVLGRQNEYYCRLDFLWKNKFKKERE
EIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTES
DVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHAQEP
ERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGN
TVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTYFVNTEMSRS
LSQGNLAS
NT seq 3087 nt   +upstreamnt  +downstreamnt
atgggagtagtgttccttttgtgggacgttgaagaccacgtggcatttttaataacggtc
ccgacagccctggcgatcttcttcgcgatcttcatcctcgtctgcatcgagtccgtgttc
aagaagctcctgcgccttttctccgtcgtgatatggatctgcctcgtggccatgggctac
ctgttcctgtgcttcggaggcaccgtctccccctgggaccaggtgtcgttcttcctcttc
atcatctttgtggtgtacaccatgctgcccttcaacatgcgggacgccatcatcgccagc
gtgctcacctcctcctcccacaccatcgtgctgagcgtctgcctgtctgcgacgccgggg
gccaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgtgggaac
ctggcgggagcgtaccacaagcacctcatggagctggccttgcagcagacgtatcaggac
acctgcaactgtatcaagtctcggatcaagctggaatttgaaaagcgtcagcaggagcgg
cttctgctctccctgctgccggctcacatagccatggaaatgaaagccgagatcatccgg
aggctgcagggccccagagccggccaaatggaaaacacaaacaacttccacaacctgtac
gtcaagcgccataccaacgtgagcatcctgtatgctgatattgttggcttcacccggctg
gccagtgactgctccccaggagaactggtccacatgctgaacgagctctttggaaagttc
gaccaaattgcaaaggagaatgaatgcatgagaataaaaattttgggagactgctactac
tgtgtgtccggacttcctatatctctcccgaaccatgccaagaactgtgtgaaaatgggg
ctggacatgtgtgaagccataaagaaagtgagggatgccactggagtggatatcaacatg
cgcgtgggagtgcattctgggaacgtcctctgcggggtgattggtctgcagaagtggcag
tacgacgtgtggtcacatgacgttaccttggccaatcacatggaagctggaggggtccct
ggacgtgttcacatttcttccgtcaccctggaacacttgaacggcgcttacaaagtggag
gaaggagacggtgacatcagagacccgtatttaaaacagcacctggtgaaaacctacttt
gtcatcaaccccaagggagaacgaaggagtcctcacctcttcagacctcgccacaccctc
gatggagccaagatgagggcctctgtgcgcatgacccggtacctggagtcctggggggcg
gccaagccctttgcacacctgcatcaccgagacagcatgaccacggagaatggcaaaatc
agcaccacggatgtgccaatgggtcagcataattttcaaaatcgtaccttaagaaccaag
tcccaaaagaagagatttgaagaagaattaaatgaaaggatgattcaagcaattgatgga
attaacgcacaaaagcagtggctcaagtctgaagacattcagagaatctcactcctgttc
tacaataaaatactagaaaaagaataccgagccaccgccctgccagcgtttaagtactac
gtgacctgcgcgtgtctcatattcttctgcgtcttcattgtgcagattctggtattacca
aaaacgtccattctggggatctcctttggagctgcgtttctcttgctcgcctttatcctc
ttcatctgctttgccgggcagcttctgcaatgcagcaagaaggcctccgcctctctcctg
tggctgttgaagtcgtcgggcatcatcgcggaccggccctggcctcgtgtctccctcact
gtcctcaccacggccatcattctgaccatggccgtgttcaacatgtttttcctgagtgac
ccagaggaaacaattcctccaactgccaattcatccaacacaagtctttctgccttaagt
aatcaggcagcgattctacgggcacaaaatctgtttttcctcccgtactttatctacagc
tgcatcctgggactgatctcctgctcggttttcctgagggtgaattacgagctgaagatg
ttgatcatgatggtggcgttggtgggttacaacaccatccttctacacacgcacgcccac
gtcctggacgactatagccaggtcttattccagagaccaggcatttggaaagacctgaag
accatgggctcagtgtctctctttatattcttcgtcacactgcttgttctgggtagacag
aatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaagagcgggag
gagatagaaaccatggaaaacctgaaccgcgtgctgctggagaacgtgctgcccgcgcac
gtggcggagcatttcctggcccggagcctgaagaacgaggagttataccaccagtcctat
gactgtgtctgcgtcatgtttgcctctattccggatttcaaagaattctacacagaatca
gatgtgaacaaggagggcttggaatgccttcggctcctgaatgagatcatcgccgacttt
gatgatctgctgtccaagccgaagttcagtggagttgaaaagatcaagaccattggcagc
acatacatggcggcgaccggtctgagcgccgtgcccagccaggagcacgcccaggagccg
gagaggcagtacatgcacattggcaccatggtggagtttgccttcgcgctggtggcgaag
ctggacgccatcaacaagcactccttcaacgacttcaagctgcgagtgggtattaaccac
ggacctgtgatagccggtgtgattggagctcagaagccgcagtatgatatctggggcaac
actgtaaacgtggccagcaggatggacagcaccggcgtgctggacaagatacaggtcacc
gaggagacaagcctcatcctccagacgctggggtacacgtgcacgtgtcgaggaataatt
aacgtgaaaggcaagggggagctgaagacgtactttgtaaacacagaaatgtcaaggtcc
ctttcccagggcaacttggcatcctga

KEGG   Ursus maritimus (polar bear): 103679331
Entry
103679331         CDS       T03271                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103679331 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103679331 (ADCY4)
   04371 Apelin signaling pathway
    103679331 (ADCY4)
   04020 Calcium signaling pathway
    103679331 (ADCY4)
   04072 Phospholipase D signaling pathway
    103679331 (ADCY4)
   04024 cAMP signaling pathway
    103679331 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103679331 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103679331 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103679331 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103679331 (ADCY4)
   04062 Chemokine signaling pathway
    103679331 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103679331 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103679331 (ADCY4)
   04912 GnRH signaling pathway
    103679331 (ADCY4)
   04913 Ovarian steroidogenesis
    103679331 (ADCY4)
   04915 Estrogen signaling pathway
    103679331 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103679331 (ADCY4)
   04921 Oxytocin signaling pathway
    103679331 (ADCY4)
   04926 Relaxin signaling pathway
    103679331 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103679331 (ADCY4)
   04918 Thyroid hormone synthesis
    103679331 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103679331 (ADCY4)
   04916 Melanogenesis
    103679331 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103679331 (ADCY4)
   04927 Cortisol synthesis and secretion
    103679331 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103679331 (ADCY4)
   04270 Vascular smooth muscle contraction
    103679331 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103679331 (ADCY4)
   04971 Gastric acid secretion
    103679331 (ADCY4)
   04972 Pancreatic secretion
    103679331 (ADCY4)
   04976 Bile secretion
    103679331 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103679331 (ADCY4)
   04727 GABAergic synapse
    103679331 (ADCY4)
   04725 Cholinergic synapse
    103679331 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103679331 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103679331 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103679331 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103679331 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103679331 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103679331 (ADCY4)
   04714 Thermogenesis
    103679331 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679331 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103679331 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103679331 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103679331 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679331 (ADCY4)
   05163 Human cytomegalovirus infection
    103679331 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103679331 (ADCY4)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103679331 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103679331
NCBI-ProteinID: XP_008707065
UniProt: A0A384DJU5
LinkDB
Position
Un
AA seq 1074 aa
LFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLAMLAVASASGRDLASDRGFLT
TVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGLGHGFLFTGGLVSAWDQVSFF
LFVIFTVYAMLPLGMRDAAAGGLASSLSHLLALGLYLGPQRDSRPALLPQLAANAVLFLC
GNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEI
MARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFG
KFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDI
NMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGVYA
VEDASMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPQMRPSLLMTRYLE
SWGAAKPFAHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEDLDTGDAKFFQ
VIEQLNSQKQWKQSKDFNPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFFSNFIIQM
LVANRPPALAITYSITFLLFLLLLFVCFSEHLTKCVLKGPKMLHWLPALSGLVATRPGLR
VALGTATILLVFVMAITSLFFLPAATNCPSRASNVSSVASNVSWELPGSLPLISVPYSMH
CCVLGFLSCSLFLHMSFELKLLLLLLWLGVSCSLFLHSHAWLSDCLIARLYPDPLDSRPG
VLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDAQQDAERSCSHLGTMVEFA
VALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVVGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3225 nt   +upstreamnt  +downstreamnt
ctcttcagtccccggccgccccccagcgaagacctcttctacgagacctactacagcctg
agccagcagtacccactgctgcttctgctgctggtgattgtgctctgtgcgctcctggcg
atgctggctgtcgcctccgccagcggcagggatctagcttcagaccggggcttcctgacc
accgtgctgtgtgcgctcggtggcttctcgctgctcctgggcctggcttcccgcgagcaa
cgactgcagcgctggacacgtcccctgtcagtcctcgtgtgggctgcgctactcgggcta
ggccatggcttcctgttcaccgggggcctggtgagcgcctgggaccaggtgtcctttttc
ctcttcgtcatcttcaccgtgtacgccatgttgcccttgggcatgcgggatgccgccgcc
gggggccttgcctcgtcgctttcccacctgctggcccttgggctgtaccttgggcctcag
cgggactccaggccagcgctgctgccgcagctggcagcgaacgccgtgttgttcttgtgc
gggaacgtggccggagcgtaccacaaggcgctgatggagcgcgctctgcgcgccacgttc
cgggaggctcttcgttccctgcactcgcgccggcggctggacacagagaagaagcaccag
gaacaccttctcttgtccattcttcctgcctacctggcccgagagatgaaggcagagatc
atggcacggctgcaggctggacaggggtcccggccagagagcaccaacaacttccacagc
ctctatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttcaca
cggctggccagtgagtgctcccctaaggagctggtgctcatgctcaacgagctcttcggc
aagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctgggagactgt
tactactgtgtctctggtctaccgctctccctgccagaccacgccatcaactgcgtgcgc
atggggctggacatgtgccgggccatcaggaaactccgggcggccactggcgtggacatc
aacatgcgtgtgggcgtgcattcgggcagtgtgctctgcggagtcattgggctgcagaag
tggcagtatgatgtctggtcccatgatgtcacactggccaaccacatggaggcgggcggc
gtgccaggacgagtacatattacaggggctaccctggccctgctggccggggtctatgct
gtggaagatgcatcgatggaacaccgggacccataccttcgggagctaggggagcccacc
tacctagtcatcgacccccgggctgaggaggaggatgagaagggcactgcgggagggctg
ctgtcctctctcgagggcccccagatgcgcccatcactgctgatgacccgctacctggag
tcctggggcgcggccaagccttttgcccatctgagccacctagagagccctgtgtccact
tccacccctctcccggagaaggccctggcctccttcagcccccagtggagcctggaccgg
agccgtaccccccggggactagatgaggacctggacactggggatgccaagttcttccag
gtcatcgaacagctcaactctcagaagcagtggaagcagtccaaggacttcaacccactg
acactgtacttcagagagaaggagctggagaaagagtatcgactttctgccctccccgcc
ttcaaatactatgcggcctgcaccttcctggtcttcttctccaacttcatcatccagatg
ctggtggccaacaggccgccagctctggccatcacctatagcatcaccttcctcctcttc
ctcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggcccc
aagatgctgcactggctgcccgcactgtctggcttggtggccacacggcccggactccga
gttgccctgggcactgccaccatcctcctcgtttttgtcatggctattaccagcctgttc
ttcttaccggcggcaacaaactgcccttcccgggcttccaatgtgtcctccgtggcttcc
aacgtctcctgggagctccctggctccctgcctctcatcagcgtcccatactctatgcac
tgctgcgtgctggggttcctgtcctgctccctctttctgcacatgagcttcgagctgaag
ttgctgctgctcctgctatggctgggggtctcctgctccctcttcctgcactcccacgcc
tggctgtccgactgcctcatcgcccgcctctatccagatcccttggactccaggccaggg
gtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttcttcaccctc
cttgtcctggctcggcagaatgagtactactgccgcctggacttcctgtggaagaagaag
ctgcggcaggagcaggaggagacagagaccatggagaacctgactcggctgctgctggag
aatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgcaacgaggac
ctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagttccagactttaag
gagttttactctgaatctaacatcaaccacgagggtctagagtgtctgcggttgctcaat
gagatcatcgctgattttgatgagctgctctcaaagcccaagtttagcggcgtggagaag
atcaaaaccatcggcagcacctacatggcagccacgggcttaaatgccacccccggacag
gacgcacagcaggatgccgagcgaagctgcagccacctgggcaccatggtggagttcgca
gtggccctcggatcgaagctggatgtcatcaacaagcactcattcaacaacttccgcctg
cgtgtggggttgaaccacggacctgtagtggctggggtggttggggcccagaagcctcag
tatgacatctggggcaacacggtgaacgtggccagccgcatggaaagtacgggagtcctg
ggcaagatccaagtgactgaagagacagcccgggtgctgcagtccttaggctatacctgc
tacagccggggcatcatcaaggtcaaaggcaaagggcagctgtgcacctacttcctgaac
acagatttgacacgaactggccctccctcggccaccctaggctga

DBGET integrated database retrieval system