KEGG   Ursus maritimus (polar bear): 103661742
Entry
103661742         CDS       T03271                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05160  Hepatitis C
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661742 (EGF)
   04012 ErbB signaling pathway
    103661742 (EGF)
   04014 Ras signaling pathway
    103661742 (EGF)
   04015 Rap1 signaling pathway
    103661742 (EGF)
   04630 JAK-STAT signaling pathway
    103661742 (EGF)
   04066 HIF-1 signaling pathway
    103661742 (EGF)
   04068 FoxO signaling pathway
    103661742 (EGF)
   04020 Calcium signaling pathway
    103661742 (EGF)
   04072 Phospholipase D signaling pathway
    103661742 (EGF)
   04151 PI3K-Akt signaling pathway
    103661742 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103661742 (EGF)
   04540 Gap junction
    103661742 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103661742 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661742 (EGF)
   05231 Choline metabolism in cancer
    103661742 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103661742 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103661742 (EGF)
   05212 Pancreatic cancer
    103661742 (EGF)
   05226 Gastric cancer
    103661742 (EGF)
   05214 Glioma
    103661742 (EGF)
   05218 Melanoma
    103661742 (EGF)
   05219 Bladder cancer
    103661742 (EGF)
   05215 Prostate cancer
    103661742 (EGF)
   05213 Endometrial cancer
    103661742 (EGF)
   05224 Breast cancer
    103661742 (EGF)
   05223 Non-small cell lung cancer
    103661742 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103661742 (EGF)
   05165 Human papillomavirus infection
    103661742 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103661742 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103661742 (EGF)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103661742 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Plasmod_Pvs28 Tme5_EGF_like
Other DBs
NCBI-GeneID: 103661742
NCBI-ProteinID: XP_008687650
UniProt: A0A384BZR2
LinkDB
Position
Un
AA seq 1155 aa
MLLFLIILLPVVFQCSFASLSVLQRWNCPGGSPSGRGNSTCVGPAPFLIFSHGSSIFRID
LGGTNHEQLVADAGVSVIMDFHYNEGRIYWVDLERKLLQRVFLNGTRQESICNIEKNVSG
MAVNWINEELIWSNQQEGIITVTDMKGDNSRVLLSALNYPANVAIDPVERFIFWSSEVAG
SLHRADLNGVEEKILLKTSARITAVSLDVLDKRLFWIQYNRDESNSYICSCNYDGGSVHF
SKHLTQHNLFAVSLFGDRIFYSAWKKKTIWIANKHTGKDMVKINLDPSFVPPGGIKVVHP
LLQPKAERGTQAPDQRLCKWRKGNCRGGMCGQDSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNTSKCSHDCVLTSDGPV
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRRMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEAVDVPEGLAIDWIDRKFYWTDRGKSFIEGSDLSGKHREIIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSNLVWPSGITIDYLTDKLYWCD
AKLSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGAQPCLHQNGGCEHICKERFGTAQCLCREGFVKAPDGKMC
LALNGHQIPAGNEADQVTPLDVLSRNRGFEDNITESQHLLVAEIMVSDADDCGPVGCSTR
AQCVSEGDNATCQCLKGFTGDGKLCFDIDECETGTTVCPPTSSKCVNTEGGYVCRCSEGY
RGDGIHCLDINECQLGMHTCGENATCTNTEGNYTCMCAGSLSEPGRICADSTPPSHLMED
GRHSVRNSYRECPSSYEGYCLYNGVCMYIEAVDRYACKTKKLPSKNLKNPYEESSREVSS
SRPTDNEARMASCPQPWFVVIKEHQNLRNGSQPMAVKDGEVADVSQSSSLEPGSVQQTSW
RNEPQVSMGAEQGCHPPPSSDRGSGPQAMEQSFPLPSYGARPIALGIEKPHSLLSGNPYX
QQRAPDPPHQKKRTW
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgctgctcttcctcatcattctgttgccggtagtttttcagtgtagttttgctagtctc
tcagtcctgcaacgctggaactgtcctggaggctctccctcaggaagggggaattctact
tgtgtgggtcctgcacccttcttgattttctcccatggaagcagtatctttaggattgac
ctgggaggaactaatcatgagcaattggtggcagatgctggcgtatcagtgatcatggat
tttcattacaatgagggaagaatctattgggtagatttagagagaaaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagcatatgcaatatagagaaaaatgtttcagga
atggcagtaaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggagacaattcccgagttctcttaagcgccttaaattatcct
gcaaatgtagcaattgatccagtagaaaggtttatattttggtcgtcagaggtggctggc
agccttcacagagccgatctcaacggtgtggaagagaagattctgttaaagacgtcagca
agaataacagctgtgtcattggatgtgcttgataagcggcttttttggattcagtacaac
agagatgaaagcaattcttatatttgttcctgtaattatgatggaggttctgtccatttt
agcaaacatctcacacagcacaatttgtttgcagtgtccctttttggtgatcggatcttc
tattcagcatggaaaaagaagacaatttggatagctaacaaacacaccgggaaggatatg
gttaaaattaacctcgacccatcgtttgtaccacctggcggaatcaaagtagtgcatccg
ctcttgcagcccaaggcagagaggggtactcaggcacctgatcagagactctgcaaatgg
aggaaaggtaactgcagaggcggcatgtgtggtcaagactcgaagtcccatctgtgcaca
tgtgcagaaggatatactttaagccaagatggaaagtactgtgaagatgtcaatgaatgt
gccttttggaaccatggctgtactcttgggtgtgaaaacatccctggatcttattattgc
acatgtcctgtaggatttattctgcttcctgatgggaaacggtgtcatcaattaatttcc
tgtccaagcaatacttctaaatgtagccatgactgtgttctgacatcagatggtcctgta
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtagtggctgttcc
tcacctgataatggtggatgcagccagctctgcctccctctcagccctgtctcctgggag
tgtggttgctttcctgggtatgacctccaactggacaagaaaagctgtgtggcgtcagga
ccacagccatttttgctgtttgctaattctcaagatattcgacgcatgcattttgatgga
acagattatggaaccctgctcagccagcaaatgggaatggtttttgcccttgatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaagcagtagatgtgcctgaaggtctt
gccatcgattggattgaccgtaaattctactggacagacagagggaaatctttcattgaa
gggagtgatttaagtggaaaacatcgtgaaataatcatcaaggaggacatctctcagcca
cgaggaattgctgtccatccaatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttctcttcaaggcattggccgactggttatagctagttccaat
ctggtctggcccagtggaataacaattgattacttaactgacaaactgtattggtgtgat
gccaagctgtctgtgatcgaaatggccaatctggatggttcaaaacgccaaaggcttgcc
cagaacgatgtagggcacccctttgctgtggctgtgtttgaggatcatgtgtggttctcg
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccttcatcactggttgtagttcatccattggcaaaacca
ggagcacagccctgcttacatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaactgctcagtgtttgtgtcgcgaaggttttgtgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatcagataccggcaggtaatgaagcagatcaagtaacaccattg
gacgtcttatccaggaacagaggatttgaagataacattacagaatctcagcatttgcta
gtggctgaaatcatggtatcagatgctgatgactgcggtcctgtgggatgcagtacacga
gctcagtgtgtttcagagggagacaatgccacatgtcagtgtttgaaaggatttactggg
gatggaaaactatgttttgatatagatgaatgtgagacgggcaccacagtttgccctcct
acctcctctaagtgtgtcaataccgaaggcggctatgtctgccggtgctcagaaggctac
cgaggcgatgggattcactgtcttgatattaatgagtgccaattgggcatgcacacctgt
ggggaaaatgccacctgtacaaatacggaggggaactacacctgcatgtgtgctggcagc
ctgtctgaacctgggcggatatgcgctgactctactccgccttctcatctcatggaagat
ggccgccattctgtgagaaatagttaccgggaatgcccctcatcctatgagggctactgc
ctctataatggtgtgtgtatgtacatcgaagcagttgacagatacgcatgcaagactaag
aagctgccatcaaaaaatttaaagaatccttacgaagagtcaagcagagaagttagcagt
agcaggcctacagacaacgaggccaggatggcctcttgtccccagccttggtttgtggtg
ataaaggaacaccaaaatctcaggaatggaagtcaacctatggctgtcaaggacggtgag
gtagcagatgttagccagtcctcctctctggagccaggctcagtgcaacagacgtcatgg
agaaatgaaccccaggtgtctatgggcgcagagcaaggctgccatcctccaccatccagt
gatagaggctctggtccccaggcaatggagcagagctttcctctcccctcctatggggca
cggcccattgctttggggatcgagaagccccattctctcctgtcaggtaacccttatngg
caacaaagggccccagatccaccacaccaaaagaagcggacttggtga

DBGET integrated database retrieval system