KEGG   Ursus maritimus (polar bear): 103661761
Entry
103661761         CDS       T03271                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04012  ErbB signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04114  Oocyte meiosis
umr04217  Necroptosis
umr04261  Adrenergic signaling in cardiomyocytes
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04934  Cushing syndrome
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103661761 (CAMK2D)
   04310 Wnt signaling pathway
    103661761 (CAMK2D)
   04066 HIF-1 signaling pathway
    103661761 (CAMK2D)
   04020 Calcium signaling pathway
    103661761 (CAMK2D)
   04024 cAMP signaling pathway
    103661761 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103661761 (CAMK2D)
   04217 Necroptosis
    103661761 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103661761 (CAMK2D)
   04922 Glucagon signaling pathway
    103661761 (CAMK2D)
   04912 GnRH signaling pathway
    103661761 (CAMK2D)
   04921 Oxytocin signaling pathway
    103661761 (CAMK2D)
   04916 Melanogenesis
    103661761 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    103661761 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103661761 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    103661761 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    103661761 (CAMK2D)
   04728 Dopaminergic synapse
    103661761 (CAMK2D)
   04720 Long-term potentiation
    103661761 (CAMK2D)
   04722 Neurotrophin signaling pathway
    103661761 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    103661761 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    103661761 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    103661761 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103661761 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661761 (CAMK2D)
   05205 Proteoglycans in cancer
    103661761 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    103661761 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103661761 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    103661761 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    103661761 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103661761 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103661761 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103661761 (CAMK2D)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103661761 (CAMK2D)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103661761 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 103661761
NCBI-ProteinID: XP_008687672
UniProt: A0A384BYK3
LinkDB
Position
Un
AA seq 512 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAKSLLKKPDGVKEPQTTVIHNPDGNKESTESSNTTIEDEDVKARK
QEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSN
KPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHF
HRSGSPTVPIKPSCIPNGKENFSGSTSLWQNI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggctttctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaaga
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcatgacagcata
tcagaagagggcttccattatttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagagtattacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcacacccggatat
ctttctccagaagttttacgtaaagatccttatggaaagccggtggatatgtgggcatgc
ggtgtcattctctatatcctcctggtgggatatccacccttctgggatgaagatcaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagagtgggacaca
gtgactcctgaagccaaagacctaattaataaaatgcttactatcaaccccgccaagcgt
atcacagcttcagaggcactgaaacacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagaccgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttttcagccaagagtttgttg
aagaaaccagatggagtaaaggagccccaaactactgtaatccacaaccctgatggaaac
aaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacgaaag
caagaaattatcaaagtcactgaacagctgattgaagccatcaacaatggagactttgaa
gcttacacaaaaatctgtgatccaggccttactgcttttgaacctgaagctttgggtaat
ttagtggaagggatggactttcaccgattctactttgaaaatgctttgtccaaaagcaat
aaaccaatccacacaattatcctgaacccccatgtgcacctggtaggtgatgatgccgcc
tgcatagcatacattaggcttacgcagtacatggatggcagcggaatgccaaagacaatg
cagtcagaagagactcgcgtgtggcatcgccgggatggaaagtggcagaacgttcatttt
catcgctctgggtcgccaacagtacccatcaagccgtcctgtattccaaatgggaaagaa
aacttctcaggaagcacctctttgtggcaaaacatctaa

KEGG   Ursus maritimus (polar bear): 103664598
Entry
103664598         CDS       T03271                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04012  ErbB signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04114  Oocyte meiosis
umr04217  Necroptosis
umr04261  Adrenergic signaling in cardiomyocytes
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04934  Cushing syndrome
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103664598 (CAMK2A)
   04310 Wnt signaling pathway
    103664598 (CAMK2A)
   04066 HIF-1 signaling pathway
    103664598 (CAMK2A)
   04020 Calcium signaling pathway
    103664598 (CAMK2A)
   04024 cAMP signaling pathway
    103664598 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103664598 (CAMK2A)
   04217 Necroptosis
    103664598 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103664598 (CAMK2A)
   04922 Glucagon signaling pathway
    103664598 (CAMK2A)
   04912 GnRH signaling pathway
    103664598 (CAMK2A)
   04921 Oxytocin signaling pathway
    103664598 (CAMK2A)
   04916 Melanogenesis
    103664598 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    103664598 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103664598 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    103664598 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    103664598 (CAMK2A)
   04728 Dopaminergic synapse
    103664598 (CAMK2A)
   04720 Long-term potentiation
    103664598 (CAMK2A)
   04722 Neurotrophin signaling pathway
    103664598 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    103664598 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    103664598 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    103664598 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103664598 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664598 (CAMK2A)
   05205 Proteoglycans in cancer
    103664598 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    103664598 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103664598 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    103664598 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    103664598 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103664598 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103664598 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103664598 (CAMK2A)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103664598 (CAMK2A)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103664598 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo Pkinase_fungal SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 103664598
NCBI-ProteinID: XP_008690733
UniProt: A0A384C7A3
LinkDB
Position
Un
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRIAAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPQ
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctcggtggtgcgccgttgcgtgaaggtgctggctggccaggagtatgct
gcaaagatcatcaacaccaagaagctctcagccagagaccatcagaagctggagcgcgaa
gcccgcatctgtcgcctgctgaagcaccccaacatcgtccggctccacgacagcatctcc
gaggagggacatcattacctgatcttcgacctggttaccggtggggagctgtttgaggac
atcgtggcccgggagtattacagtgaggccgatgccagtcactgtatccagcagatcctg
gaagccgtgctgcactgtcatcagatgggcgtggtgcaccgcgacctgaagccggagaat
ctgctgttggcctccaagctcaagggggccgcggtgaaactggcagacttcggcctggcc
atcgaggtggagggggagcagcaggcatggttcgggttcgcaggcacgccaggatacctc
tccccagaagtgctgcggaaggacccgtacgggaagcccgtggacctgtgggcctgtggg
gtcatcctctacatcctgctggttgggtaccccccattctgggacgaggaccagcaccgc
ctgtatcagcagatcaaagccggcgcctatgatttcccgtcaccagaatgggacaccgtc
accccggaagccaaggatctcatcaataagatgctgaccatcaacccgtccaagcgcatc
gcggctgctgaggccctcaagcacccctggatctcgcaccggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggagccatcctcaccacgatgctggctaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaaggaatcttcagagagtaccaacaccaccatcgaggac
gaagacaccaaagtgcggaaacaggagattattaaagtgacagagcagctgattgaagcc
ataagcaatggagattttgagtcctacacgaagatgtgtgaccccgggatgacggccttc
gaacctgaggccctggggaacctggtcgagggcctggacttccatcgattctattttgaa
aacctgtggtctcggaacagcaagcccgtgcacaccaccatcctgaacccccatatccac
ctgatgggcgacgagtcggcctgcatcgcctatatccgcatcacgcagtacctggatgcg
ggcggcatcccccgcacggcccagtcggaggagacccgcgtctggcaccgccgggatggc
aaatggcagatcgtccacttccacagatctggggcgccctccgtcctgccccagtaa

KEGG   Ursus maritimus (polar bear): 103668027
Entry
103668027         CDS       T03271                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04012  ErbB signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04114  Oocyte meiosis
umr04217  Necroptosis
umr04261  Adrenergic signaling in cardiomyocytes
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04934  Cushing syndrome
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103668027 (CAMK2G)
   04310 Wnt signaling pathway
    103668027 (CAMK2G)
   04066 HIF-1 signaling pathway
    103668027 (CAMK2G)
   04020 Calcium signaling pathway
    103668027 (CAMK2G)
   04024 cAMP signaling pathway
    103668027 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103668027 (CAMK2G)
   04217 Necroptosis
    103668027 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103668027 (CAMK2G)
   04922 Glucagon signaling pathway
    103668027 (CAMK2G)
   04912 GnRH signaling pathway
    103668027 (CAMK2G)
   04921 Oxytocin signaling pathway
    103668027 (CAMK2G)
   04916 Melanogenesis
    103668027 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    103668027 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103668027 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    103668027 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    103668027 (CAMK2G)
   04728 Dopaminergic synapse
    103668027 (CAMK2G)
   04720 Long-term potentiation
    103668027 (CAMK2G)
   04722 Neurotrophin signaling pathway
    103668027 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    103668027 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    103668027 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    103668027 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103668027 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668027 (CAMK2G)
   05205 Proteoglycans in cancer
    103668027 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    103668027 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103668027 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    103668027 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    103668027 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103668027 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103668027 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103668027 (CAMK2G)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103668027 (CAMK2G)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103668027 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal SnoaL_2 Kdo RIO1
Other DBs
NCBI-GeneID: 103668027
NCBI-ProteinID: XP_008694527
UniProt: A0A384CI94
LinkDB
Position
Un
AA seq 564 aa
MGASLFSDLKRVCVTLLCSVSQFFPPSPSRGAFSVVRRCVKKTSTQEYAAKIINTKKLSA
RDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEAD
ASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWF
GFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYD
FPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLR
KFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTA
MEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSAGM
QPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDF
HKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRV
WHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgggagcgtcgctgttctcagacctgaagcgtgtctgtgtcactctgctctgctccgtg
tcccagttctttcccccttctccctccaggggtgctttctctgtggtccgcaggtgtgtg
aagaaaacctccacgcaagaatatgcagcaaaaatcatcaataccaagaagttatctgcc
cgggatcaccagaagctagaacgtgaggcccggatatgccgacttttgaaacatccaaac
attgtgcgcctccatgacagtatttctgaagaagggtttcactacctcgtgtttgacctt
gttaccggcggggagctgtttgaagacatcgtggccagagagtactacagtgaagctgat
gccagccactgtatacatcagattctggagagtgttaaccacatccaccagcatgacatt
gtccaccgggacctgaagcctgagaacctgctgctagcgagtaaatgcaagggtgccgcc
gtcaagctggctgattttggcctagccatcgaagtacagggagagcagcaggcttggttt
ggttttgctggtaccccaggttacttgtcccctgaggtcttgaggaaagatccctatgga
aaacctgtggatatctgggcctgcggggtcatcctgtatatcctcctggtgggataccct
cccttctgggatgaggatcagcacaagttgtatcagcaaatcaaggctggggcctatgat
ttcccatcaccagagtgggacacagtgactcctgaagccaagaacttgatcaaccagatg
ctgaccataaaccctgcaaagcgcatcacagctgaccaggctctcaagcatccatgggtc
tgtcaacgatccacggtggcatccatgatgcatcgtcaagagactgtggagtgcttgcgc
aagttcaatgctcggagaaaactgaagggtgccatcctcacgaccatgcttgtctccaga
aacttttcagctgccaaaagcctactgaacaagaagtcggacggtggtgtcaagccacag
agcaacaacaaaaacagtctcgtaagcccagcccaagagcccgcgcccttgcagacggcc
atggagccacaaaccaccgtggtacacaacgctacagatgggatcaagggctccacagag
agctgcaacaccaccacagaagatgaagacctcaaagctgccccgctccgcactgggaat
ggcagctcggtgcctgaaggacggagctcccgggacagaacagccccctctgcaggcatg
cagccccagccttctctctgctcctcagccatgcgaaaacaggagatcattaagatcaca
gaacaactgattgaggccatcaacaatggggattttgaagcctacacgaagatttgtgat
ccaggcctcacttcctttgagcctgaggcccttggtaacctcgtggaggggatggatttc
cataagttttactttgagaatcttctgtccaagaacagcaagcccatccacaccaccatc
ctgaacccgcacgtccacgtgatcggggaggacgcagcttgcatcgcctacatccgcctc
acccagtacatcgatgggcagggtcggcctcgcaccagccagtcggaggagacccgggtc
tggcaccgccgggatggcaagtggctcaatgtccactatcactgctcaggagcccctgct
gcaccgctgcagtga

KEGG   Ursus maritimus (polar bear): 103672536
Entry
103672536         CDS       T03271                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103672536 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103672536 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    103672536 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103672536 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103672536 (CAMK1G)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103672536 (CAMK1G)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103672536 (CAMK1G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal APH RIO1 CsgA YrbL-PhoP_reg 5_nucleotid
Other DBs
NCBI-GeneID: 103672536
NCBI-ProteinID: XP_008699469
UniProt: A0A384CY96
LinkDB
Position
Un
AA seq 362 aa
MRQASPKASTLEAMGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGK
LFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFD
RILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGL
SKMEQSGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKL
FEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRDI
YPSVSLQIQKNFAKSKWRRCSEPTLLKKANKKQNYKSEVMVPVKAGGGSHCRAGQTGVCL
IM
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaggcaagcatcccccaaagcttcaactctggaggcgatgggtcgaaaggaagaagat
gactgcagctcctggaagaaacagaccaccaacatccggaaaaccttcatcttcatggaa
gtgctgggatcaggagctttttcagaagttttcctggtgaagcagagggtgactgggaag
ctcttcgccctgaagtgcatcaagaagtcacctgccttccgggacagcagtctggagaat
gagattgccgtgttgaaaaagatcaagcacgaaaacatcgtgaccctagaggacatctat
gagagcaccactcactactacctggtcatgcagcttgtttctggcggggaactctttgac
cggatcctggagcggggtgtctacacagagaaggatgccagcctggtgatccagcaggtc
ttgtcagcagtgaaatacctccacgagaatggcatcgtccacagagacttaaagcctgaa
aacctgctgtacctaacccctgaagaaaattccaagatcatgatcacagactttggtctg
tccaagatggaacagagcggagtcatgtccactgcctgtgggaccccaggctacgtggct
ccggaagtattggcccagaaaccctacagcaaggcggtggattgctggtccattggcgtc
atcacttacatattgttgtgtgggtatccccccttctatgaagaaacagagtctaagctt
ttcgagaagatcaaggaaggctactatgaatttgagtctccattttgggatgacatttct
gagtcagccaaggattttatttgccacctgctggagaaggacccgaatgaacggtacacc
tgtgagaaggccttgaggcacccctggattgacggaaacacagccctccaccgggacatc
tacccatcagtcagtctccagatccagaagaactttgccaagagcaagtggaggcgctgc
tccgagcccacgctcctcaaaaaagccaacaagaaacagaactacaaatcagaggtcatg
gtgccagtgaaagcgggtggcggttcccactgccgggcgggccagactggagtgtgtctc
atcatgtga

KEGG   Ursus maritimus (polar bear): 103674683
Entry
103674683         CDS       T03271                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04012  ErbB signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04114  Oocyte meiosis
umr04217  Necroptosis
umr04261  Adrenergic signaling in cardiomyocytes
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04934  Cushing syndrome
umr04971  Gastric acid secretion
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103674683 (CAMK2B)
   04310 Wnt signaling pathway
    103674683 (CAMK2B)
   04066 HIF-1 signaling pathway
    103674683 (CAMK2B)
   04020 Calcium signaling pathway
    103674683 (CAMK2B)
   04024 cAMP signaling pathway
    103674683 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103674683 (CAMK2B)
   04217 Necroptosis
    103674683 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103674683 (CAMK2B)
   04922 Glucagon signaling pathway
    103674683 (CAMK2B)
   04912 GnRH signaling pathway
    103674683 (CAMK2B)
   04921 Oxytocin signaling pathway
    103674683 (CAMK2B)
   04916 Melanogenesis
    103674683 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    103674683 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103674683 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    103674683 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    103674683 (CAMK2B)
   04728 Dopaminergic synapse
    103674683 (CAMK2B)
   04720 Long-term potentiation
    103674683 (CAMK2B)
   04722 Neurotrophin signaling pathway
    103674683 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    103674683 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    103674683 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    103674683 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103674683 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674683 (CAMK2B)
   05205 Proteoglycans in cancer
    103674683 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    103674683 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103674683 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    103674683 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    103674683 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103674683 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103674683 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103674683 (CAMK2B)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103674683 (CAMK2B)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103674683 (CAMK2B)
SSDB
Motif
Pfam: CaMKII_AD Pkinase DUF4440 SnoaL_3 SnoaL_2
Other DBs
NCBI-GeneID: 103674683
NCBI-ProteinID: XP_008701819
UniProt: A0A384D4V4
LinkDB
Position
Un
AA seq 611 aa
MLLPPSETFDESRLHCLELARFVALGRTRWASRGAFSVVRRCVKLCTGHEYAAKIINTKK
LSARDHQKLEREARICRLLKHSNIEKEKKAPRNVPQGPPGLSRLGAQGEATGAEEAAAGG
GEVCSPPRFHRGSWKVVAGHISGAGGFEEGAGSRQAWHECHKVWVTLVTGGELFEDIVAR
EYYSEADASGSRAAGRRRRSVAWRTAQRSPSGSLEQVPGAAGSSCVLPQPGGSWSQGAPW
PALLPPGVTSSVDTVFLAVCAFLGALKWQCGLSGPARREGGLGRGLGVLGAPGGVILYIL
LVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEAL
KHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADA
VKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKARK
QEVIKITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNS
KPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHF
HCSGAPVAPLQ
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcttctccctccctccgaaacctttgatgagtcccggctgcactgcttggagctggcc
cggttcgtggctctggggaggactcgctgggcctcacggggggctttctctgtggtccgg
cgctgtgtcaagctctgcactggccatgagtatgcggccaagatcatcaacacgaagaag
ctgtcagccagagatcaccagaagctggagagagaggctcggatctgccgtcttctgaaa
cattccaacatcgagaaggagaagaaggcccccaggaatgtccctcaggggcccccaggc
ctttctcggcttggagctcaaggggaggcgactggggcagaggaggctgcagctggaggg
ggtgaagtctgctcgccgccccgatttcacagggggtcctggaaggtggtcgcgggacac
atctccggtgctgggggatttgaggaaggagccggatctcggcaggcctggcatgagtgt
cacaaagtctgggtaacgctggtcacgggcggggagctgtttgaggacatcgtggccaga
gagtactacagcgaggcggatgccagtggcagccgggcagccgggcggaggcgtcggtcc
gtggcctggcggacagcccagcggagcccttccgggagccttgagcaggtcccaggagca
gcgggcagctcgtgtgtcctcccccagcctggaggctcgtggagtcagggagcaccctgg
ccggctctgctccccccgggggtgacgagcagtgttgacacggtctttctggcggtgtgc
gcctttctcggggcactgaaatggcagtgtggtctcagtgggcctgcccgtcgggagggc
ggcctggggcgggggctgggggtgctcggagccccgggaggggtgatcctatacatcctg
cttgtgggctacccacccttctgggacgaggaccagcacaagctgtaccagcagatcaag
gcaggagcctacgactttccatcccccgagtgggacacggtcactcccgaagccaaaaac
ctcattaaccagatgctgaccatcaaccctgccaagcgcatcacggcgcacgaagcgctg
aagcacccgtgggtctgccaacgctccaccgtggcctccatgatgcataggcaggagact
gtggagtgcttgaaaaagttcaatgcccggaggaagctcaagggcgcgatcctcaccacc
atgctggccacgagaaatttctcagcagccaagagtttactcaataagaaggcggacgcg
gtgaagccccagacaaatagcaccaaaaacagcgctgctgccaccagcccaaaggggaca
cttcctccggccgccctggagcctcaaaccaccgtcattcataaccccgtggacgggatc
aaggagtcatcggacagcactcacaccaccatagaggatgaggacacaaaagcgcggaag
caggaggtcatcaagatcacggagcagctcatcgaggccgtcaacaatggggacttcgag
gcctatgcgaaaatctgtgacccaggcctgacctcgttcgagcctgaagctctgggcaat
ttggtcgaagggatggacttccacagattctacttcgagaacctgctcgccaagaacagc
aagcccatccacacgaccatcctgaacccgcacgtgcacgtcatcggggaggacgcagcg
tgcatcgcctacatccgcctgacgcagtacatcgacgggcagggccggccccgcaccagc
cagtccgaggagacgcgcgtgtggcaccgccgcgatggcaagtggcagaacgtgcatttc
cactgctcgggcgcgcccgtggccccgctgcagtga

KEGG   Ursus maritimus (polar bear): 103675811
Entry
103675811         CDS       T03271                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04211  Longevity regulating pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103675811 (CAMK4)
   04020 Calcium signaling pathway
    103675811 (CAMK4)
   04024 cAMP signaling pathway
    103675811 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103675811 (CAMK4)
   04925 Aldosterone synthesis and secretion
    103675811 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    103675811 (CAMK4)
   04720 Long-term potentiation
    103675811 (CAMK4)
   04722 Neurotrophin signaling pathway
    103675811 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103675811 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    103675811 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103675811 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    103675811 (CAMK4)
   05034 Alcoholism
    103675811 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103675811 (CAMK4)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103675811 (CAMK4)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103675811 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 103675811
NCBI-ProteinID: XP_008703165
UniProt: A0A384D8Q2
LinkDB
Position
Un
AA seq 602 aa
MCQDALVIQHMVSRYVLRSGMLLGRSPPALSGPVTIRGEPPPNRCVQSISKLQARKIEHG
KLGSPLAAVVDGVGRSVQGSSMVVLGQCLHPVLVMLAVQAEELGACGGAPTVLKEAVPAA
AQQRLFQLKTSLKVFCPCSTLSCSSVTASVAPGAGSLVPDYWIEGSNRDALSDFFEVESE
LGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETP
TEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLL
YATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIIT
YILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTT
FQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHSSIQD
SQKASQAPSLTQDGSEDVKSISEGEKVQGGGAQVAVEGAEAELMKVQAIGEVKDADRNAT
NATSVVPKALEDGIKVADPEIEEGLVEEKLKNMEEAAAPKEGQENPALGFGAQQNDAILP
EY
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgtgccaggacgcattggtgattcagcacatggtctccaggtatgtgttgagatctgga
atgctcctaggcaggtcacctccagctttaagtggacctgtcactatacgaggagaacca
cctccaaatagatgcgtccaatcaatctctaagttgcaagctaggaagatagagcatggg
aaactggggagtcctctggcagcagtggtggatggagtgggacggagtgtccagggcagc
tccatggtggtgctagggcagtgtctgcatccagtgctggtgatgttggcagtgcaagct
gaagaacttggtgcttgtggcggagctccaacagtgctaaaggaggcggtgcctgcggca
gcacagcagcgtctcttccaactgaagacttcactcaaagttttttgcccatgctccacc
ttgtcctgctcttcggtcaccgccagtgtggccccgggggctgggagcctcgtcccggat
tactggatcgaaggttccaacagggatgctttgagcgatttcttcgaggtggaatcggag
ctgggacggggtgctacatccattgtgtacagatgcaaacagaaggggacgcagaagcct
tatgctctcaaagtgttaaagaaaacagtggacaaaaaaatcgtaagaactgagatagga
gttcttcttcgcctctcacatccaaacatcataaaactgaaagagatatttgaaacccct
acagaaatcagtctggtcctagaactggtcacaggaggagaactgtttgacaggattgtg
gagaagggatattacagtgagcgagacgctgcagatgctgttaaacaaatcctggaggca
gttgcctacctacatgaaaatgggattgtccatcgtgatctcaaaccagagaatcttctc
tatgcaactccagcccccgatgcaccactcaaaatcgctgattttggactctctaaaatt
gtggaacatcaagtactcatgaagacagtgtgtggaaccccagggtactgcgcacctgaa
attcttagaggctgtgcctatggacctgaggtggacatgtggtctgtaggaataatcacc
tacatcttactttgtggattcgaaccattctatgatgaaagaggtgatcagttcatgttc
aggagaattctgaattgtgaatactactttatctccccctggtgggatgaagtatctcta
aatgccaaggacctggtcagaaaactaattgttttggatcctaagaaacggctgactacc
ttccaagctctgcagcacccatgggtcacaggtaaagcagccaattttgtgcacatggat
actgcccaaaagaagctccaagagttcaatgcccggcgcaagcttaaggcagcagtgaaa
gccgtcgtggcctcttcccggctgggaagcgctagcagcagccacagcagcatccaagac
agccagaaggccagccaagcaccgtctctgacccaggatggcagtgaagatgttaaatct
atttcagaaggagagaaagttcaaggaggtggggcccaagtggcagttgagggggcagag
gccgagctgatgaaggtacaggccataggggaagttaaagatgctgatagaaatgctacc
aacgccaccagcgtggtgcccaaggcactagaggatggcataaaggtggctgacccggaa
atagaggagggcctagtagaggagaagctgaagaacatggaggaagcagcagcccccaaa
gaagggcaagaaaacccggctctgggatttggagctcagcagaatgatgcgatcctgcca
gagtattga

KEGG   Ursus maritimus (polar bear): 103676294
Entry
103676294         CDS       T03271                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr05214  Glioma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103676294 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103676294 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    103676294 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103676294 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676294 (CAMK1D)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103676294 (CAMK1D)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103676294 (CAMK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal RIO1 APH 5_nucleotid Tyrosinase Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 103676294
NCBI-ProteinID: XP_008703679
UniProt: A0A384DA61
LinkDB
Position
Un
AA seq 375 aa
MSFLRRNHSGSIPVCSKVTACGAFSEVVLAEEKASGRLFAVKCIPKKALKGKESSIENEI
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLD
AVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAP
EVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISD
SAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNFAKSKWRQAF
NATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSLVSSSSGVSGVGAER
RPRPTTVTTVHSGSK
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagctttctccgcaggaaccattctgggagcatccctgtttgctccaaggtgactgcc
tgtggggcgttttctgaagtggtcttagccgaagagaaggccagtggaagactctttgcg
gtgaagtgcatccctaagaaggcgctgaagggcaaggagagcagcatagagaacgagata
gctgttctgagaaagattaagcatgaaaacattgtcgccctggaggacatttacgaaagc
ccaaatcacttgtacttggtcatgcagcttgtatccggtggagagctgtttgatcggata
gtggagaaaggattttacacagaaaaagatgccagcactctgattcgccaggtcttggat
gctgtctactatctccatagaatgggcattgtccacagggacctcaagcctgaaaatctg
ttgtactacagtcaagatgaggaatccaaaataatgatcagtgacttcggattgtcaaaa
atggagggcaaaggagatgtgatgtccacagcctgtgggaccccaggctatgttgctcct
gaggtcctggcccagaaaccgtacagcaaagctgttgactgctggtccattggggtgatt
gcctatattttgctctgcggctaccctcctttttatgatgaaaatgattccaagctcttt
gagcagatcctcaaggcagaatatgagttcgactccccctactgggatgacatctccgac
tctgcaaaagacttcatccggaatctgatggagaaagatccaaataaaagatacacttgt
gagcaagcagctcggcacccatggatcgctggtgacacagccctcaacaaaaacatccac
gagtctgtcagtgcccagatccggaagaacttcgcaaaaagcaaatggagacaagcattt
aatgccacggccgtcgtgaggcatatgaggaaactccatcttggcagcagcctggacagt
tcgaatgcaagcgtttccagcagcctcagcttggccagtcaaaaagattgtctggcaccc
tccacgctctgtagtctcgtttcttcttcatcgggggtctctggagtgggggcagagcgg
agaccaaggcccaccactgtgaccacagtgcactctggaagcaagtga

DBGET integrated database retrieval system