KEGG   Ursus maritimus (polar bear): 103662093
Entry
103662093         CDS       T03271                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04020  Calcium signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04072  Phospholipase D signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04750  Inflammatory mediator regulation of TRP channels
umr04919  Thyroid hormone signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103662093 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103662093 (PLCG2)
   04014 Ras signaling pathway
    103662093 (PLCG2)
   04370 VEGF signaling pathway
    103662093 (PLCG2)
   04064 NF-kappa B signaling pathway
    103662093 (PLCG2)
   04066 HIF-1 signaling pathway
    103662093 (PLCG2)
   04020 Calcium signaling pathway
    103662093 (PLCG2)
   04070 Phosphatidylinositol signaling system
    103662093 (PLCG2)
   04072 Phospholipase D signaling pathway
    103662093 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103662093 (PLCG2)
   04613 Neutrophil extracellular trap formation
    103662093 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    103662093 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    103662093 (PLCG2)
   04662 B cell receptor signaling pathway
    103662093 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    103662093 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    103662093 (PLCG2)
   04670 Leukocyte transendothelial migration
    103662093 (PLCG2)
   04062 Chemokine signaling pathway
    103662093 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103662093 (PLCG2)
   04919 Thyroid hormone signaling pathway
    103662093 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103662093 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103662093 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    103662093 (PLCG2)
   04380 Osteoclast differentiation
    103662093 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662093 (PLCG2)
   05206 MicroRNAs in cancer
    103662093 (PLCG2)
   05205 Proteoglycans in cancer
    103662093 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103662093 (PLCG2)
   05214 Glioma
    103662093 (PLCG2)
   05223 Non-small cell lung cancer
    103662093 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103662093 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103662093 (PLCG2)
   05171 Coronavirus disease - COVID-19
    103662093 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103662093 (PLCG2)
   05169 Epstein-Barr virus infection
    103662093 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103662093 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103662093 (PLCG2)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103662093 (PLCG2)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103662093 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103662093 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 PH_14
Other DBs
NCBI-GeneID: 103662093
NCBI-ProteinID: XP_008687971
UniProt: A0A384BZE8
LinkDB
Position
Un
AA seq 1265 aa
MTALVNVDTLPEYEKSQIKRALELGTVMTVFSFRKYTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTVLYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFLEIGAHKDELSFEQFHLFYKNLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLLHEQQELWAQDLTKVRERMTKFIHDTVRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDQLLMKPTEASADQLPSPSQLRERIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEKR
ASAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYF
LTDNLTFTSIYALIQHYRETHLRCTEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTFDGEEMEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKQFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKMDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPMPPESQRKILMTLSVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAATQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLVSEETPFSLC
VCVKRNNMTLNNQMQSPPTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccgccctggtcaacgtggacacccttcctgagtacgagaagagtcagatcaagaga
gcgctggagctgggcacagtgatgacggtgttcagtttccgcaagtacaccccagagcgg
aggaccgtccaggtgatcatggagacgcgccaggtggcctggagcaagacagccgacaag
atcgagggcttcttggatatcatggaaatcaaggaaatccgcccagggaagaactccaag
gactttgagcgtgccaaagctgtccgccagaaggaagactgctgctttaccgtcctgtac
ggcacccagtttgttctcagcacgctcagcttggcagccgactccaaagaagatgcgact
aagtggctgtctggcttgaaaatcttacaccaggaagcaatgagcgcctccacacccacc
attattgagagttggctgagaaagcagatttattcagtggatcaaaccagaagaaacagc
atcagcctccgagagctgaagaccatcttacccctggtcaacttcaaagtgaacagtgcc
aagttcctcaaagataagtttctggaaatcggcgcgcacaaagatgaactcagcttcgag
cagttccacctgttctacaaaaaccttatgtttgagcaacaaaagtcgattcttgacgaa
ttcaaaaaagattcttctgtgttcatcttgggcaacaccgacaggccggacgcctccgcc
gtttacctgcacgacttccagcgctttctcttacacgagcagcaggagctttgggctcag
gatctgaccaaagtccgtgagcggatgactaagtttatccacgacaccgtgagggaaact
gctgagcccttcttgtttgtcgatgagttcctcacgtacctgttctcgcgggagaacagc
atctgggatgagaagtacgacgtggtggacatgcaggacatgaacaaccccttgtcgcat
tactggatctcctcttcgcataacacgtacctcaccggtgaccaactgcggagcgagtca
tccacggaagcgtacgtccgctgcctgcggatgggctgtcgctgcattgagctggactgc
tgggatgggcccgacgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacttcaagcttccca
gtgatcctgtccatcgaggagcactgttgcgttgaacagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgaccagctgctgatgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaggataatcatcaagcataagaagctgggcccg
cgaggtgacgtggatgtcaacatggaggataagaaagatgagcacaaacaacagggtgaa
ctgtacatgtgggattccatcgaccagaagtggactcggcactactgtgccatcgctgat
gccaagctgtcgttcagcgacgacattgaacagactgcagaagaggaactgccccaggac
ataccccctacggagctgcactttggggaggagtggttccacaagaaggtggagaagagg
gcgagtgccgagaagctgctgcaggaatactgtgcggagacagggggcaaggatgggacc
ttcctggtgcgggagagcaagaccttccccaacgactacacgctgtccttctggcggtcc
ggccgggtccagcactgccggatccgttccaccatggagggcgggaccatgaagtacttc
ctgactgacaacctcacgttcaccagcatctatgccctcatccagcactaccgcgagacg
cacctgcgttgcacagagtttgagctccggctcaccgaccctgtgcccaaccccaacccc
cacgagtcaaagccgtggtactatgatgggctgagccgcggggaagcagaggacatgctc
atgagggttcctcgggatggcgccttcctgatccggaggcgggagggcaccgactcctac
gccatcaccttcagggccaggggcaaggtaaagcactgtcgcattcaccgggacggccgg
cactttgtgctggggacctcggcctactttgagagcctcgtggagctcgtcagctactac
gagaagcacgcgctctaccggaagatgcggctgcgctaccccgtgacgccggagctcctg
gagcgctacaatatggaaagagacataaactccctctatgacgtcagcagaatgtatgtg
gatcccagcgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggggccctcattcacaacgtctcc
aaggaaccctggggctggtggaaaggagactatgggaccagaatccagcagtacttccca
tccaattacgtcgaggacatttcaacattcgacggggaggagatggagaagcagattatt
gaagacaatcccttagggtctctttgtaggggaatattggatctcaacacctataacgtc
gtgaaagccccccaggggaaaaaccagaaacagttcgtgtttatcctggagcccaagaag
caaggcgaccccccagtcgagtttgccacggacaaggtggaggagctcttcgagtggttc
cagagcatccgggagatcacctggaagatggacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctggtagtttactgcaagccgacc
agcaagaccaaggataatctagaaaaccccgacttccgagaaatccgctcctttgtggag
acgaaggcggacagtgtcgtcaggcagaaacccatcgacctcctgaagtacaatcagaag
ggcctgacccgtgtttacccaaagggacagagggtggactcctccaactacgaccccttt
cgcctctggctgtgcggctcccagatggtggcactcaacttccagacgccagacaagtac
atgcagatgaatcacgccttgttctcactcaacgggcggacgggctacgtcctccagcct
gagagcatgaggtccgagaagtatgaccccatgccaccggagtcccagaggaagatcctg
atgactctgtcagtcaaggttctcggggctcgccatctccccaagcttggacgaagtatt
gcgtgtccctttgtggaggtggaaatctgcggagccgaatatgacaacaacaagtttaag
acaacagttgtgaatgacaatggcctaagtcctgtttgggctgcaacacaggagaaagtg
acctttgaaatttacgaccccaacctggcatttctgcgctttgtggtctacgaggaagat
atgttcagtgatcccaatttcctcgcccacgccacttaccccatcaaaggaatcaaatca
ggattcagatctgttcctctgaagaacgggtacagcgaagacattgagctggcttccctc
ctggttttctgtgagatgcagccagtcctggtgagtgaagaaacgccctttagtttgtgt
gtgtgtgtgaaacgaaacaacatgacactaaacaaccagatgcagagcccccccacgcac
cagaacttgcgcaacgccaaccgggatgccctcgtgaaagagttcaacgtcaatgagaac
cagctccagctctatcaggagaagtgcaatcggaggttgagagagaagagggtcagcaac
agcaggttttactcctag

KEGG   Ursus maritimus (polar bear): 103669754
Entry
103669754         CDS       T03271                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04072  Phospholipase D signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04613  Neutrophil extracellular trap formation
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04750  Inflammatory mediator regulation of TRP channels
umr04919  Thyroid hormone signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05135  Yersinia infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103669754 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103669754 (PLCG1)
   04014 Ras signaling pathway
    103669754 (PLCG1)
   04015 Rap1 signaling pathway
    103669754 (PLCG1)
   04370 VEGF signaling pathway
    103669754 (PLCG1)
   04064 NF-kappa B signaling pathway
    103669754 (PLCG1)
   04066 HIF-1 signaling pathway
    103669754 (PLCG1)
   04020 Calcium signaling pathway
    103669754 (PLCG1)
   04070 Phosphatidylinositol signaling system
    103669754 (PLCG1)
   04072 Phospholipase D signaling pathway
    103669754 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103669754 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    103669754 (PLCG1)
   04660 T cell receptor signaling pathway
    103669754 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    103669754 (PLCG1)
   04659 Th17 cell differentiation
    103669754 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    103669754 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    103669754 (PLCG1)
   04670 Leukocyte transendothelial migration
    103669754 (PLCG1)
   04062 Chemokine signaling pathway
    103669754 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103669754 (PLCG1)
   04919 Thyroid hormone signaling pathway
    103669754 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103669754 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103669754 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    103669754 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669754 (PLCG1)
   05206 MicroRNAs in cancer
    103669754 (PLCG1)
   05205 Proteoglycans in cancer
    103669754 (PLCG1)
   05231 Choline metabolism in cancer
    103669754 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103669754 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103669754 (PLCG1)
   05214 Glioma
    103669754 (PLCG1)
   05223 Non-small cell lung cancer
    103669754 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103669754 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    103669754 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103669754 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103669754 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103669754 (PLCG1)
   05171 Coronavirus disease - COVID-19
    103669754 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103669754 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103669754 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103669754 (PLCG1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103669754 (PLCG1)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103669754 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103669754 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 GDPD
Other DBs
NCBI-GeneID: 103669754
NCBI-ProteinID: XP_008696318
UniProt: A0A384CND8
LinkDB
Position
Un
AA seq 1092 aa
MLDPFGLRCWLGAGLCLLRAAHCLRAAPATWLPGAPLLSHRAGERPELCRVSLPEFQQFL
LEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFSLDEFVTFLFSKENSVWNSQLDAVC
PDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVI
YHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLL
TKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLE
DPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSSEKWFHGKLGAG
RDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGA
PKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQA
EHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLI
SYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKA
LFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPASLEPE
REHLDENSPLGDLLRGVLDVPACQIAIRPEGKNSRLFVFSISMASVAHWSLDVAADSQEE
LQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYR
DMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVAL
NFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPYAICIEVLGAR
HLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLR
FVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDVFPAKQEN
GDLSPFSMSLRERGSDTSGQLFHGRAREGSFEARYQQPFEDFRISQEQLADHFDIRERRA
PRRTRVNGDNRL
NT seq 3279 nt   +upstreamnt  +downstreamnt
atgctggacccttttgggctacggtgctggttgggagctgggctctgccttctaagggcc
gctcattgtctacgggctgcgccagccacctggctgccaggtgctccccttctttcccac
agggctggggagcggccagagctctgtcgtgtgtcccttcctgagttccagcagttcctc
ctcgagtaccagggggagctgtgggctgttgaccggcttcaggtgcaggagttcatgctc
agcttccttcgagaccccttgcgagaaattgaagagccatacttctccctggatgagttt
gtcaccttcctgttctcgaaagagaacagtgtgtggaactcgcagctggatgcagtgtgc
ccagataccatgaacaatcctctctcccactactggatctcttcctcccacaacacgtac
ctgaccggggaccagttctccagcgagtcctccctagaagcctacgctcgctgcctgcgg
atgggctgtcgctgcattgagttggactgctgggacggcccagatgggatgccagtcatt
taccatggacacacccttaccaccaagatcaagttctcggacgttctgcacaccatcaag
gagcatgccttcgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagc
attgctcagcagagaaatatggcacagtatttcaagaaggtgcttggggacacactcctt
accaagcccgtggacatcgctgccgacgggctcccctcgcccaaccagctcaagaggaag
atcctcatcaagcacaagaagctggcggagggcagcgcctacgaagaggtgcctacgtcg
gtgatgtactccgagaatgatatcagcaactccatcaagaatggcatcctctacctggag
gaccccgtgaaccatgaatggtacccccactacttcgttctgaccagcagcaagatctac
tactctgaggagaccagcagcgaccagggcaatgaggatgaggaggagcccaaggaggcc
agtggcagcacagagctgcactccagtgagaagtggttccatgggaagctcggggcggga
cgggacggacggcacatcgctgagcgcctgctcaccgagtactgcatcgagaccggggcc
cctgatggctccttcctcgtgcgggagagcgagaccttcgtgggcgactacaccctctct
ttctggaggaacggaaaagtccagcactgccggatccactcccggcaggacgctggggcc
cccaagttcttcttgacagacaacttggtctttgactcactctatgacctcatcacgcac
taccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctctcagagcctgtcccg
cagaccaatgcccacgagagcaaagagtggtaccacgccagcctgaccagagctcaggct
gagcacatgctgatgcgtgtcccccgggatggggccttcctggtgagaaaacggaatgag
cccaactcctacgccatctccttccgggccgagggcaagatcaagcattgccgcgtccag
caggagggccagacggtgatgctgggcaactcggagtttgacagcctcgtggacctcatc
agctactatgagaagcacccgctgtaccgcaagatgaagctgcgctaccccatcaacgag
gaggcgctagagaagatcggcaccgctgagcctgactatggagccttgtatgagggacgc
aaccctggcttctacgtggaggcaaatcctatgccgactttcaagtgtgcggtcaaagcc
ctctttgactacaaggcccagagggaggacgagctgacgttcacaaagagcgccatcatc
cagaacgtggagaagcaagaaggcggctggtggcggggggactacggggggaagaagcag
ctgtggttcccgtcaaactacgtggaggagatggtcagccctgcatccctggagccggag
agggagcacttggacgagaacagccccctgggggacttgctccggggggtcttggatgtg
ccggcttgtcagattgccatccgtcctgagggcaagaacagccggctcttcgtcttctcc
atcagcatggcttcagtggcgcactggtccttggacgtcgctgctgactcacaggaggag
ctgcaggactgggtgaagaagatccgagaagtggcccagacggcagatgccaggctcacg
gaggggaagatgatggagcgcaggaagaagattgccctggagctctccgagctggttgtc
tactgtcggcctgttcccttcgatgaagagaagattggcacagaacgtgcctgctaccgg
gacatgtcgtcctttccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaag
aagttcctccagtacaaccgcctgcagctctcccgcatctaccccaagggccagcggcta
gactcctccaattacgaccccttgcccatgtggatctgcggcagtcagctggtggccctc
aacttccagacgccagacaagcctatgcagatgaaccaggcgctcttcatggccggcggc
cactgcggctacgtgctgcagcccagcaccatgcgggatgaggcctttgacccctttgac
aagagcagcctccgaggcctagagccatatgccatctgcattgaggtgctgggggcccgg
cacctgccaaagaatggccgaggcatcgtgtgtccttttgtggagattgaggtggccgga
gcggaatatgacagcatcaagcagaagacagagtttgtggtggacaatggactgaaccct
gtgtggcctgccaagcccttccacttccagatcagtaacccggaattcgcctttttgcgc
tttgtggtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctaccttc
ccggtgaaaggcctgaagacaggatacagagccgtgcctttgaagaacaactacagtgag
gacttggagctggcctccctgctcgtcaagatcgatgttttccctgccaagcaggagaac
ggggacctcagtcccttcagtatgtctctgcgggagcggggctccgatacctcaggccag
ctgtttcatggccgggcccgggaaggttcctttgaagcccgctaccagcagccatttgag
gactttcgtatctcccaggagcagctggcagaccattttgacattcgggaacggagggcc
ccacgaaggactcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system