KEGG   Ursus maritimus (polar bear): 103662147
Entry
103662147         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103662147
   04151 PI3K-Akt signaling pathway
    103662147
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103662147
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103662147
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103662147
   04621 NOD-like receptor signaling pathway
    103662147
   04622 RIG-I-like receptor signaling pathway
    103662147
   04623 Cytosolic DNA-sensing pathway
    103662147
   04650 Natural killer cell mediated cytotoxicity
    103662147
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662147
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103662147
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103662147
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103662147
   05161 Hepatitis B
    103662147
   05160 Hepatitis C
    103662147
   05171 Coronavirus disease - COVID-19
    103662147
   05164 Influenza A
    103662147
   05162 Measles
    103662147
   05168 Herpes simplex virus 1 infection
    103662147
   05163 Human cytomegalovirus infection
    103662147
   05167 Kaposi sarcoma-associated herpesvirus infection
    103662147
   05169 Epstein-Barr virus infection
    103662147
   05165 Human papillomavirus infection
    103662147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103662147
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103662147
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103662147
NCBI-ProteinID: XP_008688016
UniProt: A0A384BZJ2
LinkDB
Position
Un
AA seq 228 aa
METDVFPFKRAHKARCSENLEPRFPDLPTPARPAASAGSPMALPFSFLVALVVLSGNSLC
SLGCDLPQNHGLFAWRALTLLGQMKRISLISCVHKYTHDFAFPKEVVDGKQLQKAQALSV
VHVMNQKIFHIFCTEASSAAWNTTLLEEFCSGLSEQLSVLEACPMQAAGVGETPGMNVDS
ILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTTLQERLRGKK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaactgatgtgttcccatttaagagggctcacaaggcaagatgctcagagaaccta
gagccacggttcccagacttgcccaccccagccaggccagcagcctctgcaggatcccca
atggccctgcccttctccttcttggtggccctggtggtactcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatctcccttatctcttgtgtacacaagtacacacatgacttt
gccttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtc
gtgcatgtgatgaaccagaagatcttccacatcttctgcacagaggcctcatctgctgct
tggaacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctg
gaagcctgtcccatgcaggcggcgggagtgggagagactcccggcatgaatgtggactcc
atcctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagccct
tgtgcctgggagactgtcagagcagaaatcacgagctccttgttttcatcaacaaccttg
caagaaaggttaaggggcaagaaatga

KEGG   Ursus maritimus (polar bear): 103662148
Entry
103662148         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103662148
   04151 PI3K-Akt signaling pathway
    103662148
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103662148
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103662148
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103662148
   04621 NOD-like receptor signaling pathway
    103662148
   04622 RIG-I-like receptor signaling pathway
    103662148
   04623 Cytosolic DNA-sensing pathway
    103662148
   04650 Natural killer cell mediated cytotoxicity
    103662148
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662148
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103662148
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103662148
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103662148
   05161 Hepatitis B
    103662148
   05160 Hepatitis C
    103662148
   05171 Coronavirus disease - COVID-19
    103662148
   05164 Influenza A
    103662148
   05162 Measles
    103662148
   05168 Herpes simplex virus 1 infection
    103662148
   05163 Human cytomegalovirus infection
    103662148
   05167 Kaposi sarcoma-associated herpesvirus infection
    103662148
   05169 Epstein-Barr virus infection
    103662148
   05165 Human papillomavirus infection
    103662148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103662148
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103662148
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103662148
NCBI-ProteinID: XP_008688017
UniProt: A0A384BZL0
LinkDB
Position
Un
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKKMFASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEASSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAAGVGETPGMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTILQ
ERLRHKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagaaaatgtttgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagaggcctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgggagtgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcatcaacgatcttgcaa
gaaagactacggcacaagaaatga

KEGG   Ursus maritimus (polar bear): 103662149
Entry
103662149         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103662149
   04151 PI3K-Akt signaling pathway
    103662149
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103662149
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103662149
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103662149
   04621 NOD-like receptor signaling pathway
    103662149
   04622 RIG-I-like receptor signaling pathway
    103662149
   04623 Cytosolic DNA-sensing pathway
    103662149
   04650 Natural killer cell mediated cytotoxicity
    103662149
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662149
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103662149
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103662149
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103662149
   05161 Hepatitis B
    103662149
   05160 Hepatitis C
    103662149
   05171 Coronavirus disease - COVID-19
    103662149
   05164 Influenza A
    103662149
   05162 Measles
    103662149
   05168 Herpes simplex virus 1 infection
    103662149
   05163 Human cytomegalovirus infection
    103662149
   05167 Kaposi sarcoma-associated herpesvirus infection
    103662149
   05169 Epstein-Barr virus infection
    103662149
   05165 Human papillomavirus infection
    103662149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103662149
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103662149
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103662149
NCBI-ProteinID: XP_008688018
UniProt: A0A384BZK0
LinkDB
Position
Un
AA seq 183 aa
MALSISVLLALVMLCSSPACSLDCTLRPSHPEPFVLLSQMERISILSCLKDRTDFSFPQM
LVDGSKFEKTEATAVMHEMFQQIFNLFSQSGSLVAWDETPLDKFLAGLHQQLEDLETCLE
EEKNVEQLLLGSENSRLAVKRYFHGIGLYLEKKKYSRCAWEVVRVEIRRCLFFVNELAGK
LRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccctctcgatctctgtgctgctggccctggtgatgctgtgctccagccctgcctgc
tctttggactgcaccctgcgtccaagccatccagaaccctttgtgctgttgagtcaaatg
gagagaatctccattctatcctgtctgaaggataggactgacttcagctttcctcagatg
cttgtggatgggagcaagtttgagaagacagaagccacagctgtcatgcatgagatgttc
cagcagatcttcaacctcttcagccaaagtggctctcttgtggcttgggatgagacccca
ctagacaaattcctcgctggacttcatcagcagctggaagacctggagacatgtttggag
gaggaaaagaatgtggaacagttactcctgggaagcgagaactccagactggctgtgaag
agatacttccatggaatcggtctctatcttgaaaagaaaaaatacagccgctgtgcctgg
gaggttgtcagggtggaaatcagaaggtgcttgttcttcgttaacgagctcgcagggaaa
ctcaggaaataa

KEGG   Ursus maritimus (polar bear): 103662193
Entry
103662193         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103662193
   04151 PI3K-Akt signaling pathway
    103662193
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103662193
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103662193
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103662193
   04621 NOD-like receptor signaling pathway
    103662193
   04622 RIG-I-like receptor signaling pathway
    103662193
   04623 Cytosolic DNA-sensing pathway
    103662193
   04650 Natural killer cell mediated cytotoxicity
    103662193
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662193
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103662193
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103662193
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103662193
   05161 Hepatitis B
    103662193
   05160 Hepatitis C
    103662193
   05171 Coronavirus disease - COVID-19
    103662193
   05164 Influenza A
    103662193
   05162 Measles
    103662193
   05168 Herpes simplex virus 1 infection
    103662193
   05163 Human cytomegalovirus infection
    103662193
   05167 Kaposi sarcoma-associated herpesvirus infection
    103662193
   05169 Epstein-Barr virus infection
    103662193
   05165 Human papillomavirus infection
    103662193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103662193
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103662193
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103662193
NCBI-ProteinID: XP_008688079
UniProt: A0A384C0W4
LinkDB
Position
Un
AA seq 114 aa
MLQQVFSTFSLDVSRSLWDKSSVERLLSGLNLQTEKIEACLEQETGQADRSSSQREDTRL
GIKNYFQGIRDYLQDQKYSNCAWEVIRVEMRRCFLFTEQLTTRLQDQEIGHLHN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgctacagcaggtcttcagcactttcagcctcgatgtctcccggtctctgtgggataaa
agcagtgtagagagactcctaagtggacttaatctgcagacggagaagatagaggcatgc
ctggagcaggaaactgggcaggcggatcgctcatcctctcagagggaagataccagactt
ggaataaagaattatttccaagggatccgggactatttgcaagaccaaaagtatagcaac
tgtgcctgggaggtcatccgtgtagagatgcgaaggtgttttctgttcactgagcagctt
accacaagacttcaggaccaagaaataggtcacttacataactaa

KEGG   Ursus maritimus (polar bear): 103666985
Entry
103666985         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103666985
   04151 PI3K-Akt signaling pathway
    103666985
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103666985
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103666985
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103666985
   04621 NOD-like receptor signaling pathway
    103666985
   04622 RIG-I-like receptor signaling pathway
    103666985
   04623 Cytosolic DNA-sensing pathway
    103666985
   04650 Natural killer cell mediated cytotoxicity
    103666985
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666985
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103666985
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103666985
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103666985
   05161 Hepatitis B
    103666985
   05160 Hepatitis C
    103666985
   05171 Coronavirus disease - COVID-19
    103666985
   05164 Influenza A
    103666985
   05162 Measles
    103666985
   05168 Herpes simplex virus 1 infection
    103666985
   05163 Human cytomegalovirus infection
    103666985
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666985
   05169 Epstein-Barr virus infection
    103666985
   05165 Human papillomavirus infection
    103666985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103666985
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103666985
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103666985
NCBI-ProteinID: XP_008693288
UniProt: A0A384CEJ8
LinkDB
Position
Un
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQAFSVVYVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAAGLGETPGMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTTLQ
ERLRGKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccttctcggtcgtt
tatgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgggattgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcatcaacaaccttgcaa
gaaaggttaaggggcaagaaatga

KEGG   Ursus maritimus (polar bear): 103680385
Entry
103680385         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103680385
   04151 PI3K-Akt signaling pathway
    103680385
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103680385
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103680385
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103680385
   04621 NOD-like receptor signaling pathway
    103680385
   04622 RIG-I-like receptor signaling pathway
    103680385
   04623 Cytosolic DNA-sensing pathway
    103680385
   04650 Natural killer cell mediated cytotoxicity
    103680385
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103680385
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103680385
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103680385
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103680385
   05161 Hepatitis B
    103680385
   05160 Hepatitis C
    103680385
   05171 Coronavirus disease - COVID-19
    103680385
   05164 Influenza A
    103680385
   05162 Measles
    103680385
   05168 Herpes simplex virus 1 infection
    103680385
   05163 Human cytomegalovirus infection
    103680385
   05167 Kaposi sarcoma-associated herpesvirus infection
    103680385
   05169 Epstein-Barr virus infection
    103680385
   05165 Human papillomavirus infection
    103680385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103680385
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103680385
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103680385
NCBI-ProteinID: XP_008708139
UniProt: A0A384DN00
LinkDB
Position
Un
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNRGLFAWRALMLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAAGVGETPGMNVDSILRNYFQRISLYLQEKQYSLCAWETVRAEITSSLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactctctctgc
tctctgggctgtgacctgcctcagaaccgtggcctgtttgcctggagggccttgatgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgggagtgggagagactcctggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcctttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcatcaacgatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus maritimus (polar bear): 103680386
Entry
103680386         CDS       T03271                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103680386
   04151 PI3K-Akt signaling pathway
    103680386
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103680386
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103680386
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103680386
   04621 NOD-like receptor signaling pathway
    103680386
   04622 RIG-I-like receptor signaling pathway
    103680386
   04623 Cytosolic DNA-sensing pathway
    103680386
   04650 Natural killer cell mediated cytotoxicity
    103680386
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103680386
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103680386
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103680386
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103680386
   05161 Hepatitis B
    103680386
   05160 Hepatitis C
    103680386
   05171 Coronavirus disease - COVID-19
    103680386
   05164 Influenza A
    103680386
   05162 Measles
    103680386
   05168 Herpes simplex virus 1 infection
    103680386
   05163 Human cytomegalovirus infection
    103680386
   05167 Kaposi sarcoma-associated herpesvirus infection
    103680386
   05169 Epstein-Barr virus infection
    103680386
   05165 Human papillomavirus infection
    103680386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103680386
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interferons
   103680386
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103680386
NCBI-ProteinID: XP_008708140
UniProt: A0A384DMV8
LinkDB
Position
Un
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
PCPMQAARVGETPGMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEIMKPLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagaggatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
ccctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcatgaaacccttgttttcatcaacaatcttgcaa
gaaggactaaggcgcaagaaatga

DBGET integrated database retrieval system