KEGG   Ursus maritimus (polar bear): 103662421
Entry
103662421         CDS       T03271                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr03440  Homologous recombination
umr04064  NF-kappa B signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05170  Human immunodeficiency virus 1 infection
umr05202  Transcriptional misregulation in cancer
umr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    103662421 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103662421 (ATM)
   04068 FoxO signaling pathway
    103662421 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103662421 (ATM)
   04210 Apoptosis
    103662421 (ATM)
   04115 p53 signaling pathway
    103662421 (ATM)
   04218 Cellular senescence
    103662421 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103662421 (ATM)
   05206 MicroRNAs in cancer
    103662421 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103662421 (ATM)
   05170 Human immunodeficiency virus 1 infection
    103662421 (ATM)
   05165 Human papillomavirus infection
    103662421 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103662421 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103662421 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103662421 (ATM)
   03400 DNA repair and recombination proteins [BR:umr03400]
    103662421 (ATM)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103662421 (ATM)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103662421 (ATM)
DNA replication proteins [BR:umr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     103662421 (ATM)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103662421 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 103662421
NCBI-ProteinID: XP_008688336
UniProt: A0A384C0D5
LinkDB
Position
Un
AA seq 3057 aa
MSLALNDLLICCRHLEHDRATERRKEVEKFKRLIRDPETVQHLDRHSDSKQTKYLNWDAV
FRFLQKYVQKETECLRTAKPSVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGPVYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFGLYLKPAQ
DINRVLVARIIHAVTKGCCSQTDGLNAKFLDFFSKAIQHARQEKSSAGLNHILAAFIIFL
KTLAVNFRIRVCQLGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQVYVHHPKGAKTQEK
GAYESSKWKSILYNLYDLLINEISHIGSRGKYSSGSRNVAVKENLIELMADICHQIFNED
TRSLEISQSYTTTQRELNDYSTPCKKKKIELGWEVIKDHLQKSQSDFDLVPWLQITTQLI
SKYPSSLPNYELSPLLMILYQLLPQHRHGERTPYVLRCLTEVALCQGKKSNLEVSQKSDL
LKFWIKIWSLTFRGISSEQIQAENFGLLGAIIQGRLIEVDREFWKLFTGSACRPSCPAVC
CLTLATTVCVVPETVKTGVEHSLCELNRSCSLKELIMKWLLLYHLEDDFEDGTELPPVLH
SNFPHLAVEKILVSLTMKNCKAAMNFLQRVPECEQHQKDQEEPSFSEVEELFLQTTFDKM
DFLTIVKECAVEKHQSTVGFSVHQNLKESLDRYLLGLSEQLLHNYSSETTNAETLIRCSS
LLVGVLGCYCYVGVIAEEEAYRSELFQKAKSLMQCAGESITLFKSKTNEESRIASLRNMM
NLCTSCLCNCTKPSPNKIASRFFLRLLTSKLMNDIADICRSLASFIRKPSDFGEAESLED
EADENLMEVEDQSSMTLFSDYPPGSSSDAPMSGDGQSTFGAMNPLAEEHLSKQDLLFLDM
LKFLCVCVTTAQTSPVSFRAADIRRKLLMLIDTSMLDPTKSLHLHMYLLLLKELPGEEYP
LPMEEVVELLKPLSNVCSLYRRDQDVCKTLLNHFVHVVRNLCQGDMDAENTRDAQGQFLT
VIGAFWHLAKEGKCTFSVRMALVKCLRTLLETDPYSKWAILNVMGKDFPVNEVFPHFLAD
NHHQVSMLAAESISRLFQDMKHRGSSTLLKALPLKLQQTAFENAYLQAQEGMREVSHGAE
NPELLDEIYNRKSVLLMTIAVVLCCSPVCEKQALFALCKSVKENGLEPHLVKKVLGKVSE
TFGYRRLEDFMASHLDYLVLEWLNLQDTEHSLYSFPFILLNYTTVEDFYRSCYKVLIPHL
VIRSRFDEVKSIANQIEEDWKSLLTHCFPKILVNILPYFAYEGTGDSGMAQQRETATKVY
DMLKDENLLGKQIDHLFLSNLPEIVVELLMTLHEPAAAGTSQSTDLCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRIL
KIYHLFVTLLLKDIKSALGGAWAFVLRDVIYTLIHYINRRPSRFVDVSSRSFSLCCDLLS
QVCHTAVTYCKDALENHLHVIVGTLIPLVDDQMEVQGQVLDLLKYLVIDNKDNENLYMTI
KLLDPFPDHDVFKDLRITQQKIKYSKGPFSLLEEINHFLSVSAYDALPLTRLEGLKDLRR
QLARHKDQMAGLMRASQDNPQDGVMVKLIVSLLQLCKMAVNHTGEKEVLEAVGSCLGEVG
PVDFSTIALQHSGDTSSTKAPELFEDKELQWTFITLTYLNNTLVEDCVKVRSAAATCLKS
ILATKTGHSFWEIYKTTPDPMLIYLQPFRTSKKKFLEVPRLEKESPLEGLDDMSLWIPQS
ENHDIWIKRLTCAFLDSGGTKSEILRLLKPMCEVKTDFCQAVLPYLIHDVLLQDTEESWR
SLLSAHIQGFFTNCFRHSSPPSRSTTPANLDSESEHLFRCCVDKKSQRTMLAVVDYMRRQ
KRPSLGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKSMEDQDKRSLTFEE
ASQSTAISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKLLQPLTRLRTYEHE
AMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDHENKERCVELQELH
YQAAWRNMQWDHCLSVNKGVEGTSYHESLYNALQSLRDREFSTFYESLRYARVKEVEELC
KGGLESVYSLYPTLSRLQAIGELENIGELLARSGTDRQPSEVYAKWRKHSQLLKDSDFSF
QEPIMALRTVILEILMEKEMENSQKECFRDILTKHLVELSILARTVENTQLPERAMFQIK
QYNPATCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAENDPDLRLIYAECLR
VCGTWLAETCLENPAVIMQTYLEKAVEVARNYDGESSDELKNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDR
KRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKIDGMKIPSYKFLPL
MYQLAARMGTKMMGGLGFHEVLNNLISRIAMDHPHHTLFIILALANANKDEFLTKPEAAG
RNRITKNAPKQSSPLDEDRTEAANRIIHTIRSRRPQMVRSVEALCDAYIILANLDAAQWR
TQRKGISIPADQPITKLKNLEDVVVPTTEIKVDPTGEYRNLVTIQSFKAEFRLAGGLNLP
KIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSALHCQKKMMDVQKKSFEEKYKT
FMDVCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
SSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDDTELHSTPGGEDQECRRSLSDTD
QSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt   +upstreamnt  +downstreamnt
atgagcttagcacttaatgatctgcttatttgctgccgtcatctagaacatgatagagct
acagaacgaaggaaagaagttgagaaatttaagcgcctgattcgggatcctgaaactgtt
caacatttagatcgacattcagattccaaacaaaccaaatatttgaactgggatgctgtt
tttagatttttacagaaatatgttcagaaagaaacagaatgtctgcgaacagcgaaacca
agtgtatcagcctcaacacaagccactaggcagaaaaagatgcaagaaatcagtagtttg
gtcaagtacttcatcaaatgtgcaaataaaagagcacccagactaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctaatggtcccgtttatggagcggat
tgtagcaacattctgctcaaggacattctctcagtgaggaaatattggtgtgaaatatct
cagcaacagtggctagaattgttctctgtgtactttggtctgtaccttaaacctgcacaa
gacattaatagagttttagtggctagaataattcatgctgtgaccaaaggatgctgttca
caaaccgatggattaaatgccaaatttttggatttcttttccaaggctattcagcatgca
agacaggagaagagctctgcaggtctaaatcacatcttagcagcgtttattatcttcctc
aagactttggctgtaaactttcgaattcgagtgtgtcaactaggagatgaaattcttcct
accttgctttatatttggacccaacatagacttaacgattccttaaaagaagtaattatt
gagttatttcaactgcaagtttatgtgcatcatccaaagggagccaaaacccaagaaaaa
ggtgcttatgaatcaagtaaatggaaaagtatcttgtataacttatatgatctgctaatt
aacgagatcagtcatataggaagcagagggaaatattcttcaggatctcgtaatgttgct
gtcaaggaaaacttgattgagttgatggcagatatttgtcaccagatttttaatgaagat
actagatctttggagatttctcagtcttacactaccacccaaagagaacttaatgattac
agcacgccttgcaaaaagaagaaaatagaattaggctgggaagtgataaaagatcatctt
cagaagtcacagagtgattttgatcttgtgccttggttacagatcacaacccagttaata
tcaaaatatccttcaagtttacctaactatgagttgtcaccattactgatgatactatac
cagcttctacctcagcatcgacatggggagcgcacgccgtatgtgttacgatgccttacg
gaagttgcattgtgtcaagggaagaaatccaacctagaagtctcacaaaagtcagattta
ttgaaattctggattaaaatttggtctcttacctttcgtggtataagttctgaacaaata
caagctgaaaactttggtttacttggagctataattcaaggccgtttaattgaggtcgat
agagaattctggaagttatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgcttgactctggcaacgaccgtctgtgtggttccagaaactgtaaaaacaggagtggag
cacagtctgtgtgaattaaatagaagttgttctttaaaggaattgataatgaaatggctc
ttactctatcatttagaggatgactttgaagacggtacagagctgcctccagttcttcac
agtaattttcctcatcttgcagtggagaaaattcttgtgagtctcactatgaaaaattgt
aaagctgcaatgaattttctccaaagagtgccagaatgtgaacaacaccaaaaagatcaa
gaagagccttcattctcagaagttgaagaactgtttcttcagacaacttttgacaagatg
gattttttaaccattgtgaaagaatgtgctgtagaaaagcaccagtccaccgtaggcttt
tctgtccaccagaacctcaaggaatcactggatcgctatcttctgggcttatcagagcag
cttttacataactactcatctgagactacaaatgcagaaacgcttatccggtgttcaagt
cttttggtgggtgttcttggctgctattgttatgtgggagtaatagctgaagaggaagca
tatagatcagaactattccagaaagccaagtctctaatgcagtgtgcaggagaaagtatc
actctgttcaaaagtaagaccaatgaggaatctaggattgcttccctgagaaatatgatg
aatctctgtaccagttgcttgtgtaattgtaccaagcccagtccaaataagattgcatct
agatttttcctacgattgttgacatcaaagctcatgaatgatattgcagatatttgtaga
agtttggcatcctttatcagaaagccatctgactttggagaagcagaatcgctggaagac
gaggctgatgaaaatctgatggaggtggaggatcagtcatccatgaccctgttcagtgac
taccctcctggtagctctagtgatgcccccatgtctggagatggccagagtacttttggt
gccatgaatcctttagctgaagaacatctgtcaaagcaagatctgctctttttagacatg
ctcaagttcttgtgtgtgtgcgtaactacagctcagaccagtcctgtgtcatttagagca
gcggacattcggaggaagttgttaatgttaattgatactagcatgctagaccctactaaa
tccctccacctacacatgtatctactgcttttaaaggagcttcctggagaagaatatcct
ttgcccatggaagaggttgttgaacttctaaaaccactctccaatgtgtgttctttgtat
cgccgtgaccaggatgtttgtaaaacacttttaaaccactttgttcacgtagtgaggaac
ctgtgtcaaggggatatggatgctgaaaacacaagggatgctcaagggcagtttctgacg
gtgattggagcattctggcacctagcaaaggaggggaaatgcacattctctgtaagaatg
gcactagtgaagtgccttagaactttgcttgagaccgatccttattcaaaatgggctatt
cttaatgtaatggggaaagactttcctgtaaatgaagtatttccacattttcttgctgat
aatcatcatcaagttagcatgttggctgcagagtcaatcagcagattattccaggatatg
aaacacagaggttcatccacattattgaaagcacttcctttgaagcttcagcaaacagct
tttgaaaatgcatacttgcaagctcaggaaggaatgagagaagtgtcccatggagctgag
aaccctgaacttttggatgagatttataacagaaaatctgttttactgatgacgatagct
gtggttttatgctgtagcccagtctgtgaaaaacaggctttgtttgcgctgtgcaagtct
gtgaaagagaacggattagagcctcacctcgttaaaaaggttttagggaaagtttctgaa
acttttggatacagacgtttagaagactttatggcttctcatttggattatctggttttg
gaatggctaaatcttcaagatactgaacatagcttatattcttttccttttattttacta
aactacacaaccgttgaggatttctatagatcatgttacaaggttttgatcccacatcta
gtgattagaagtcgttttgatgaggtgaagtccattgctaatcagatcgaagaggattgg
aaaagtcttctaacacattgctttccaaagattcttgtaaatattcttccttacttcgcc
tacgagggtacaggagacagtgggatggcacagcagagagagactgctaccaaagtctac
gatatgcttaaagatgaaaatttactaggaaaacagattgatcatttattccttagtaat
ttgccggagattgttgtggagttattgatgacgttacatgagccggcagctgcaggcacc
agccaaagcacggacctgtgtgacttctcaggggatttggatcctgctcctaatccgcct
cattttccatcacatgtgattaaagcaacgtttgcctatatcagcaattgccataaaacc
aagcttaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaattctt
ctagccatatgtgagcaagctgctgagacaaataatgtttataaaaagcacagaattctt
aaaatatatcacctgtttgttactttattactgaaagatattaaaagtgccttaggagga
gcttgggcctttgttcttcgagatgttatctatactttgattcattatatcaacagaagg
ccttctcgtttcgtggatgtgtcgtcacggagcttctccctgtgttgtgacctgttaagc
caggtttgccacacggcagtcacttactgtaaggacgctctggaaaatcatctccacgtg
attgttggcacacttataccccttgtggacgatcagatggaggtgcagggacaggtgttg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatgacaatt
aaacttttagatccttttcctgaccatgatgtctttaaggatttgcgcattactcagcag
aaaattaaatacagtaaaggacccttttcgcttttggaggaaataaatcattttctctcc
gtgagtgcttatgatgcccttcccctgacaaggctggaaggcctgaaggatctccgcaga
cagctagctcggcataaggaccagatggccggcctcatgagagcatctcaggataacccg
caggacggcgtaatggtgaagctcattgtcagcttgttgcagttatgcaagatggcggtg
aaccacactggtgaaaaagaagttttagaggctgttggaagctgcctgggagaagtgggt
cctgtcgatttctccacgatagctctacagcacagcggagatacgtcttctaccaaggcc
cctgagttgtttgaagataaagaacttcagtggaccttcataaccctgacctacctgaat
aacacgctggtagaagactgtgtcaaagtgcgatcagctgctgctacctgtttgaaaagc
attttagccacaaagactggacatagtttctgggagatttataagacgacacctgatccc
atgctgatctacctacagcctttcagaacatcaaaaaaaaagtttttagaagtccccaga
ctggagaaagaaagtccgttagaaggcctggatgatatgagcctgtggattcctcaaagt
gaaaatcatgacatttggataaagaggctgacttgtgcctttttggatagtggaggcacg
aaaagtgaaattcttcgattattaaagcccatgtgtgaagtgaaaactgacttttgtcag
gctgtgcttccatacttgattcatgatgttttactccaagatacagaggaatcctggaga
agtctgctttctgcgcacattcagggatttttcactaactgtttcagacactcctcacca
ccgagccgatccacgacccctgccaatttggattcagagtcagagcacctgttccgatgc
tgtgtggacaaaaaatcacagagaacgatgcttgctgttgtggactacatgaggagacaa
aagagaccttccctaggaacagttttcgatgatgctttctggctggagttgaattatcta
gaggttgccaaggtggctcagtcttgtgctgctcactttacggcactgctttacgcagaa
atctacgcagataagaaaagcatggaagaccaagacaaaagaagtcttacgtttgaagaa
gcaagccagagtacagctatttctagtttgagtgaaaaaagtaaagaagaaactggaata
agtttacaggatctgctcttagaaatctacagaagtataggagagcccgatagtctgtat
ggctgtggtggagggaaactgctacagcccctcactagactgcgaacatatgaacatgaa
gcaatgtgggggaaagccctggtgacatatgaccttgagacggccatctcctcatcgacc
cgccaggcggggataatccaggccttgcagaatttgggactctgccatattctttccgta
tatttaaaaggactagatcatgaaaataaggagcggtgcgttgagctgcaggagctccac
taccaggcagcttggaggaacatgcagtgggaccactgcctttctgtcaacaaaggtgtg
gaaggaaccagttaccacgaatcattgtacaatgctctgcagtctctgagagatagagaa
ttctccacattttacgaaagtctcagatatgccagggtgaaagaagtggaggagctgtgc
aaggggggcctcgagtctgtgtactccctgtaccccacactcagcaggctgcaggccatc
ggtgagctcgagaacattggggagctgctcgccagatcaggcacggataggcagccctcc
gaagtatacgctaagtggcggaaacactcccagcttctcaaagacagtgatttcagtttt
caggagcccatcatggctctccgcacagtcattttggaaatcctgatggaaaaggaaatg
gagaactcccagaaagaatgttttagggacattctcaccaagcaccttgtagagctctcc
atactagcccgaactgtcgagaacactcagctccctgaaagggcaatgtttcaaattaaa
cagtataatccagctacttgtggagtctctgagtggcagctggaggaagcacaagtattt
tgggcaaaaaaggagcagagtcttgccctgagtattctcaagcagatgatcaagaagttg
gatgccagttgtgcagagaatgatcccgacctaagacttatatacgcagaatgtctgcga
gtttgcggcacctggttagcggaaacttgcctagaaaaccctgcagtcatcatgcagact
tatctagaaaaggcagtggaagttgctagaaattacgatggagaaagcagtgatgagctt
aaaaatggaaaaatgaaagcatttctctcattagcacggttctcggacactcagtaccag
agaattgaaaactacatgaaatcgtcagagtttgaaaacaagcaggctcttctgaaaagg
gccaaagaagaagtgggccttcttagggaacataaaatccagaccaacagatatacagta
aaggtccagcgggagctggagctggatgaatgtgcactccgtgcactgaaagaggaccgt
aaacgtttcctatgtaaagcagttgaaaattacatcagttgcttactgagtggagaagga
cacgatatgtggatattccgtctttgttctctctggcttgaaaattcaggagtttctgaa
gtcaatggcatgatgaagatcgatggaatgaagattccatcctacaaatttttgcccctt
atgtaccagttggctgctagaatggggaccaaaatgatgggaggcctcggatttcatgaa
gtcctcaataatcttatctctagaattgcaatggatcacccccatcacactttgtttatt
atactggctttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagcagga
aggaatagaataactaaaaatgcacctaaacaaagctctccactcgatgaggatcgaacc
gaggctgcaaataggataatacatactatcagaagtagaagacctcagatggtcagaagc
gtggaggcgctctgtgatgcttatatcatattagcaaacctagacgctgctcagtggagg
actcagagaaaaggcataagtatcccagcagaccagccaattactaaactgaagaattta
gaagatgtcgttgttccaactacagaaattaaggtggaccccaccggagaatacagaaat
ctggtgactatacagtcatttaaagcagaatttcgtttagcaggaggtttaaatttacct
aaaataatagactgtctgggctctgatggaaaggaaaggagacagctcgtcaagggccgt
gacgacctgagacaggacgcggtcatgcagcaggttttccagatgtgtaatacgttactg
cagaggaacactgagaccaggaagaggaaactgaccatctgcacatacaaggtggtcccg
ctttctcagcgaagtggagtccttgaatggtgcacaggaactgtccccatcggtgagttc
cttgtgaacaacgagaatggtgctcataagagatacaggccgaaggacttcagcgccctt
cactgccagaagaaaatgatggatgtacaaaagaagtcttttgaagagaaatataaaacg
ttcatggatgtctgccaaaaatttcaaccggttttccgttacttctgcatggaaaaattc
ttggacccagctgtttggttcgagaagcgactggcttatactcgcagcgtggctacttcc
tctatcgttggttacatacttggacttggtgatcgacatgtacagaatatcttgataaat
gagcagtctgcagaacttgtacatatagatttgggagttgcttttgaacagggtaagatc
ctccctactcctgaaacggttcctttcagactcaccagagatattgtggatgggatgggc
attactggtgttgaaggtgtcttcagaaggtgctgtgagaaaaccatggaggttatgaga
agctctcaggaaaccctgctaaccattgtggaggttctcctctacgaccccctgtttgac
tggaccatgaatcctctgaaagctctgtatttacagcagaggccggaggatgacactgag
ctgcactctactcccggtggagaggaccaggaatgcagacgcagtctcagtgacaccgac
cagagcttcaacaaagtagcggaacgcgtgttgatgagactacaagagaaactgaaagga
gtggaggagggaacggtgctcagtgttggggggcaggtgaatctgctcatacagcaagcc
atggaccccaaaaatctcagccgacttttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system