KEGG   Ursus maritimus (polar bear): 103662972
Entry
103662972         CDS       T03271                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04340  Hedgehog signaling pathway
umr04371  Apelin signaling pathway
umr04530  Tight junction
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04976  Bile secretion
umr05012  Parkinson disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103662972 (PRKACB)
   04014 Ras signaling pathway
    103662972 (PRKACB)
   04310 Wnt signaling pathway
    103662972 (PRKACB)
   04340 Hedgehog signaling pathway
    103662972 (PRKACB)
   04371 Apelin signaling pathway
    103662972 (PRKACB)
   04020 Calcium signaling pathway
    103662972 (PRKACB)
   04024 cAMP signaling pathway
    103662972 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103662972 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103662972 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103662972 (PRKACB)
   04540 Gap junction
    103662972 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103662972 (PRKACB)
   04062 Chemokine signaling pathway
    103662972 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    103662972 (PRKACB)
   04910 Insulin signaling pathway
    103662972 (PRKACB)
   04922 Glucagon signaling pathway
    103662972 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    103662972 (PRKACB)
   04912 GnRH signaling pathway
    103662972 (PRKACB)
   04913 Ovarian steroidogenesis
    103662972 (PRKACB)
   04915 Estrogen signaling pathway
    103662972 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    103662972 (PRKACB)
   04921 Oxytocin signaling pathway
    103662972 (PRKACB)
   04926 Relaxin signaling pathway
    103662972 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    103662972 (PRKACB)
   04918 Thyroid hormone synthesis
    103662972 (PRKACB)
   04919 Thyroid hormone signaling pathway
    103662972 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    103662972 (PRKACB)
   04916 Melanogenesis
    103662972 (PRKACB)
   04924 Renin secretion
    103662972 (PRKACB)
   04925 Aldosterone synthesis and secretion
    103662972 (PRKACB)
   04927 Cortisol synthesis and secretion
    103662972 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103662972 (PRKACB)
   04270 Vascular smooth muscle contraction
    103662972 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    103662972 (PRKACB)
   04971 Gastric acid secretion
    103662972 (PRKACB)
   04976 Bile secretion
    103662972 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103662972 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103662972 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103662972 (PRKACB)
   04727 GABAergic synapse
    103662972 (PRKACB)
   04725 Cholinergic synapse
    103662972 (PRKACB)
   04728 Dopaminergic synapse
    103662972 (PRKACB)
   04726 Serotonergic synapse
    103662972 (PRKACB)
   04720 Long-term potentiation
    103662972 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    103662972 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    103662972 (PRKACB)
   04742 Taste transduction
    103662972 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    103662972 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    103662972 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    103662972 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103662972 (PRKACB)
   04714 Thermogenesis
    103662972 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103662972 (PRKACB)
   05205 Proteoglycans in cancer
    103662972 (PRKACB)
   05203 Viral carcinogenesis
    103662972 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103662972 (PRKACB)
   05020 Prion disease
    103662972 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    103662972 (PRKACB)
   05031 Amphetamine addiction
    103662972 (PRKACB)
   05032 Morphine addiction
    103662972 (PRKACB)
   05034 Alcoholism
    103662972 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103662972 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103662972 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103662972 (PRKACB)
   05163 Human cytomegalovirus infection
    103662972 (PRKACB)
   05165 Human papillomavirus infection
    103662972 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103662972 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103662972 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103662972 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103662972 (PRKACB)
   03036 Chromosome and associated proteins [BR:umr03036]
    103662972 (PRKACB)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103662972 (PRKACB)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  PKA family
   103662972 (PRKACB)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103662972 (PRKACB)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103662972 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103662972
NCBI-ProteinID: XP_008688894
UniProt: A0A384C381
LinkDB
Position
Un
AA seq 397 aa
MAAYKELPCNQYTGTTALQKLEGFASRLFHRHSKSTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttataaagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactgcacatgatcag
aaaactgctctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
gctccgaataatgctggactggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcataccttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtactcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcccatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaagggtatatccaggttacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggtgtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcggatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaagcggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgccaccacagattggattgctatttaccagaggaaggttgaagcacca
ttcataccaaagttcagaggctctggagataccagcaacttcgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagagttttgtgaattttga

KEGG   Ursus maritimus (polar bear): 103682183
Entry
103682183         CDS       T03271                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04340  Hedgehog signaling pathway
umr04371  Apelin signaling pathway
umr04530  Tight junction
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04976  Bile secretion
umr05012  Parkinson disease
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103682183 (PRKACA)
   04014 Ras signaling pathway
    103682183 (PRKACA)
   04310 Wnt signaling pathway
    103682183 (PRKACA)
   04340 Hedgehog signaling pathway
    103682183 (PRKACA)
   04371 Apelin signaling pathway
    103682183 (PRKACA)
   04020 Calcium signaling pathway
    103682183 (PRKACA)
   04024 cAMP signaling pathway
    103682183 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103682183 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103682183 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103682183 (PRKACA)
   04540 Gap junction
    103682183 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103682183 (PRKACA)
   04062 Chemokine signaling pathway
    103682183 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    103682183 (PRKACA)
   04910 Insulin signaling pathway
    103682183 (PRKACA)
   04922 Glucagon signaling pathway
    103682183 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    103682183 (PRKACA)
   04912 GnRH signaling pathway
    103682183 (PRKACA)
   04913 Ovarian steroidogenesis
    103682183 (PRKACA)
   04915 Estrogen signaling pathway
    103682183 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    103682183 (PRKACA)
   04921 Oxytocin signaling pathway
    103682183 (PRKACA)
   04926 Relaxin signaling pathway
    103682183 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    103682183 (PRKACA)
   04918 Thyroid hormone synthesis
    103682183 (PRKACA)
   04919 Thyroid hormone signaling pathway
    103682183 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    103682183 (PRKACA)
   04916 Melanogenesis
    103682183 (PRKACA)
   04924 Renin secretion
    103682183 (PRKACA)
   04925 Aldosterone synthesis and secretion
    103682183 (PRKACA)
   04927 Cortisol synthesis and secretion
    103682183 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103682183 (PRKACA)
   04270 Vascular smooth muscle contraction
    103682183 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    103682183 (PRKACA)
   04971 Gastric acid secretion
    103682183 (PRKACA)
   04976 Bile secretion
    103682183 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103682183 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103682183 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103682183 (PRKACA)
   04727 GABAergic synapse
    103682183 (PRKACA)
   04725 Cholinergic synapse
    103682183 (PRKACA)
   04728 Dopaminergic synapse
    103682183 (PRKACA)
   04726 Serotonergic synapse
    103682183 (PRKACA)
   04720 Long-term potentiation
    103682183 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    103682183 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    103682183 (PRKACA)
   04742 Taste transduction
    103682183 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    103682183 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    103682183 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    103682183 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103682183 (PRKACA)
   04714 Thermogenesis
    103682183 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103682183 (PRKACA)
   05205 Proteoglycans in cancer
    103682183 (PRKACA)
   05203 Viral carcinogenesis
    103682183 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103682183 (PRKACA)
   05020 Prion disease
    103682183 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    103682183 (PRKACA)
   05031 Amphetamine addiction
    103682183 (PRKACA)
   05032 Morphine addiction
    103682183 (PRKACA)
   05034 Alcoholism
    103682183 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103682183 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103682183 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682183 (PRKACA)
   05163 Human cytomegalovirus infection
    103682183 (PRKACA)
   05165 Human papillomavirus infection
    103682183 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103682183 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103682183 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103682183 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103682183 (PRKACA)
   03036 Chromosome and associated proteins [BR:umr03036]
    103682183 (PRKACA)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103682183 (PRKACA)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  PKA family
   103682183 (PRKACA)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103682183 (PRKACA)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103682183 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103682183
NCBI-ProteinID: XP_008709992
UniProt: A0A384DSH0
LinkDB
Position
Un
AA seq 341 aa
MAQPVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFA
MKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMIMEYVPGGEMFS
HLRRIGRRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAK
RVKGRTWTLCGTPEYLAPEIILSKVGTPPPIPLPTGVLIYEMAAGYPPFFADQPIQIYEK
IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRK
VEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcccagccagtgaaagagttcttagccaaagccaaagaagattttcttaaaaaatgg
gaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatcaagaccctcggc
acgggctcctttgggcgggtgatgctggtgaagcacaaggagaccgggaaccactttgcc
atgaagatcctcgacaaacagaaggtggtgaagctgaaacagatcgagcataccctgaac
gaaaagcgcatcctgcaagcggtcaactttccgttcctcgtcaaactcgagttctccttc
aaggacaactcgaatttatacatgatcatggagtacgtgcccggcggggagatgttctcg
cacctgcggcggatcggaaggaggttcagtgagccacatgcccgcttctatgcggcccag
atcgtcctgaccttcgagtacctgcactcacttgacctcatctaccgggacctgaagccg
gagaacctcctcattgaccagcagggctacattcaggtgacagacttcggttttgccaag
cgtgtaaaaggccgcacctggaccttatgcgggacccctgagtacctggccccggagatc
attctgagcaaagtaggcacccccccacccatcccactgccaacgggagttctcatctac
gagatggctgctggctacccgcccttcttcgctgaccagcccatccagatctatgagaag
attgtctctgggaaggtgcggttcccatcccacttcagctccgacctgaaggatctgctg
cggaacctgctgcaggtggacctcaccaaacgcttcgggaacctcaagaacggagtcaat
gatatcaagaaccacaagtggtttgccacaactgactggatcgccatctaccagaggaag
gtggaagctcccttcataccaaagttcaaaggccctggggacacgagtaattttgacgac
tatgaggaggaagagatccgagtctccatcaatgagaagtgtggcaaggagtttactgag
ttttag

DBGET integrated database retrieval system