KEGG   Ursus maritimus (polar bear): 103663135
Entry
103663135         CDS       T03271                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04064  NF-kappa B signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103663135 (GADD45A)
   04064 NF-kappa B signaling pathway
    103663135 (GADD45A)
   04068 FoxO signaling pathway
    103663135 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103663135 (GADD45A)
   04210 Apoptosis
    103663135 (GADD45A)
   04115 p53 signaling pathway
    103663135 (GADD45A)
   04218 Cellular senescence
    103663135 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663135 (GADD45A)
   05202 Transcriptional misregulation in cancer
    103663135 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103663135 (GADD45A)
   05212 Pancreatic cancer
    103663135 (GADD45A)
   05225 Hepatocellular carcinoma
    103663135 (GADD45A)
   05226 Gastric cancer
    103663135 (GADD45A)
   05214 Glioma
    103663135 (GADD45A)
   05216 Thyroid cancer
    103663135 (GADD45A)
   05220 Chronic myeloid leukemia
    103663135 (GADD45A)
   05217 Basal cell carcinoma
    103663135 (GADD45A)
   05218 Melanoma
    103663135 (GADD45A)
   05213 Endometrial cancer
    103663135 (GADD45A)
   05224 Breast cancer
    103663135 (GADD45A)
   05222 Small cell lung cancer
    103663135 (GADD45A)
   05223 Non-small cell lung cancer
    103663135 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103663135 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103663135 (GADD45A)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103663135 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103663135 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae XPA_C
Other DBs
NCBI-GeneID: 103663135
NCBI-ProteinID: XP_008689054
UniProt: A0A384C3P7
LinkDB
Position
Un
AA seq 109 aa
MDEVTIRDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLEPDASPAASEGA
EQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 330 nt   +upstreamnt  +downstreamnt
atggatgaggtcaccataagagacgacgacagggatgtggctctgcagatccacttcacc
ctgatccaggcgttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggc
cgactggccgagctcctgctcctggagcccgacgccagcccagcagcgagcgagggcgcc
gagcagcccccggacttgcactgcgtcctggtgacgaatccacattcatcgcagtggaag
gaccctgccttaagtcagcttatttgtttttgccgggaaagtcgctacatggatcagtgg
gttccagtgattaatctccctgaacggtga

KEGG   Ursus maritimus (polar bear): 103681651
Entry
103681651         CDS       T03271                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04064  NF-kappa B signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103681651 (GADD45B)
   04064 NF-kappa B signaling pathway
    103681651 (GADD45B)
   04068 FoxO signaling pathway
    103681651 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103681651 (GADD45B)
   04210 Apoptosis
    103681651 (GADD45B)
   04115 p53 signaling pathway
    103681651 (GADD45B)
   04218 Cellular senescence
    103681651 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103681651 (GADD45B)
   05202 Transcriptional misregulation in cancer
    103681651 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103681651 (GADD45B)
   05212 Pancreatic cancer
    103681651 (GADD45B)
   05225 Hepatocellular carcinoma
    103681651 (GADD45B)
   05226 Gastric cancer
    103681651 (GADD45B)
   05214 Glioma
    103681651 (GADD45B)
   05216 Thyroid cancer
    103681651 (GADD45B)
   05220 Chronic myeloid leukemia
    103681651 (GADD45B)
   05217 Basal cell carcinoma
    103681651 (GADD45B)
   05218 Melanoma
    103681651 (GADD45B)
   05213 Endometrial cancer
    103681651 (GADD45B)
   05224 Breast cancer
    103681651 (GADD45B)
   05222 Small cell lung cancer
    103681651 (GADD45B)
   05223 Non-small cell lung cancer
    103681651 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103681651 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103681651 (GADD45B)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103681651 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103681651 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103681651
NCBI-ProteinID: XP_008709438
UniProt: A0A384DR34
LinkDB
Position
Un
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEPRDLHCL
LVTNPHTDTWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgttggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtagaggagctgttggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcagccaagttgatgaatgtggaccctgacagcgtggtcctgtgccttctggcc
attgatgaggaggaggaggatgacatcgccctgcagatccatttcacactcatccagtcc
ttttgctgtgacaacgacattaatatcgtccgggtgtcaggcatgcagcgcctggcccag
ctgctgggcgagccagcggagacccagggcaccaccgagccccgagacctgcactgcctc
ctggttacgaatcctcacacagacacctggaaaagccacggcctggtggaagtagccagt
tactgcgaagagagccgagggaacaaccagtgggtcccctacatctccctccaggagcgc
tga

DBGET integrated database retrieval system