KEGG   Ursus maritimus (polar bear): 103663185
Entry
103663185         CDS       T03271                                 

Gene name
SHC3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04510  Focal adhesion
umr04650  Natural killer cell mediated cytotoxicity
umr04722  Neurotrophin signaling pathway
umr04910  Insulin signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05100  Bacterial invasion of epithelial cells
umr05214  Glioma
umr05220  Chronic myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103663185 (SHC3)
   04014 Ras signaling pathway
    103663185 (SHC3)
   04072 Phospholipase D signaling pathway
    103663185 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103663185 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103663185 (SHC3)
   04062 Chemokine signaling pathway
    103663185 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103663185 (SHC3)
   04915 Estrogen signaling pathway
    103663185 (SHC3)
   04917 Prolactin signaling pathway
    103663185 (SHC3)
   04926 Relaxin signaling pathway
    103663185 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    103663185 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103663185 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103663185 (SHC3)
   05226 Gastric cancer
    103663185 (SHC3)
   05214 Glioma
    103663185 (SHC3)
   05220 Chronic myeloid leukemia
    103663185 (SHC3)
   05224 Breast cancer
    103663185 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    103663185 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103663185 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103663185 (SHC3)
   01522 Endocrine resistance
    103663185 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103663185
NCBI-ProteinID: XP_008689114
UniProt: A0A384C3V8
LinkDB
Position
Un
AA seq 448 aa
MIYVFFPLQYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFRKRKPPSKML
SSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAY
VAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFKQYLQCPSKVPAFHDRMQSLDEPW
TEEEGDGSDHPYYNSIPSKTPPPGGFVDVRLHTRPHAPDTAQFAGKEQTYYQGRHLGDPF
GEDWQQTPVRQGERQGSSDIYSMPEGRVHLAPGEAPTYVNAQHLPAQATPASGSSTESSP
RKDLFDMKPFEDALRNQSLGPVLSKAASVECISPVTPRAPDAKMLEELEGEPWYQGEMSR
KEAEGLLKKDGDFLVRKSATNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSISHL
INHHLENSVPIVSAGSELCLQQPVEKTL
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgatttacgtttttttccccttgcagtacttggggtgcattgaagttctccgctcaatg
aggtctcttgacttcagtacaagaacacagattaccagggaagccatcagccgtgtgtgt
gaagccgtccctggtgccaagggagccttcaggaagagaaagcctcccagcaaaatgctg
tccagcatcttgggcaagagcaacctccagtttgcggggatgagcatctccctgaccata
tccaccgccagcctgaacctgcgcacgcccgactcgaaacagatcatcgcgaaccaccac
atgcagtccatctccttcgcatccgggggagacccggacacaacagactacgttgcgtat
gtagcgaaggaccccgttaatcgcagagcttgtcacattctggagtgctgtgacggcctg
gcccaggatgtcatcggctctatcggacaggcctttgaactccggtttaagcaatatttg
cagtgtccttccaaggtgcccgcattccacgaccgaatgcagagtctggatgagccttgg
actgaagaggagggggacggctcagaccacccatactacaacagcatcccaagcaagacg
cctcctccagggggcttcgtggatgtgcggctgcacaccagaccccatgcccctgacaca
gcgcagtttgcaggaaaagagcaaacttactaccaggggagacacttaggagacccattt
ggcgaagactggcagcaaacacctgtcaggcaaggtgagaggcaagggtcctcggacatc
tacagcatgccggaggggagagtgcacttggcccctggagaagcccccacctacgtgaac
gcccagcacctcccagcgcaggccacgccagcctcgggcagcagcacagagagcagccct
cggaaggacctctttgacatgaaaccttttgaagatgctctcaggaaccagtccttgggg
cctgtgctgagcaaagcagcctctgtggagtgcatcagccccgtcaccccgagagcccca
gatgctaagatgctggaggagctagaaggggagccttggtaccaaggggagatgagccgg
aaggaggctgagggcctgctgaagaaagatggggacttcctggtcaggaagagcgccaca
aacccaggctccttcgtcctcacgggaatgcacaacggccaggccaagcacctgctgctc
gtggacccggaaggcacgatccggacgaaagacagggtctttgacagcatcagccacctc
atcaaccaccacctggagaacagcgtgcccatcgtctccgccggaagcgagctctgcctg
cagcagccggtggagaagaccctgtga

KEGG   Ursus maritimus (polar bear): 103668383
Entry
103668383         CDS       T03271                                 

Gene name
SHC1
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04510  Focal adhesion
umr04650  Natural killer cell mediated cytotoxicity
umr04722  Neurotrophin signaling pathway
umr04910  Insulin signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05100  Bacterial invasion of epithelial cells
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05220  Chronic myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103668383 (SHC1)
   04014 Ras signaling pathway
    103668383 (SHC1)
   04072 Phospholipase D signaling pathway
    103668383 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103668383 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103668383 (SHC1)
   04062 Chemokine signaling pathway
    103668383 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103668383 (SHC1)
   04915 Estrogen signaling pathway
    103668383 (SHC1)
   04917 Prolactin signaling pathway
    103668383 (SHC1)
   04926 Relaxin signaling pathway
    103668383 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    103668383 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103668383 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103668383 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103668383 (SHC1)
   05226 Gastric cancer
    103668383 (SHC1)
   05214 Glioma
    103668383 (SHC1)
   05220 Chronic myeloid leukemia
    103668383 (SHC1)
   05224 Breast cancer
    103668383 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    103668383 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103668383 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103668383 (SHC1)
   01522 Endocrine resistance
    103668383 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 103668383
NCBI-ProteinID: XP_008694819
UniProt: A0A384CK19
LinkDB
Position
Un
AA seq 582 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGIVGXMPDSGPLPLLQDMNKLSGGGGRR
TRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDF
NTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSL
NLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVI
STIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLG
GVVDMRLREGAPLGAARSTPPGVQTPSHLGATLPVGQPVGGDPEIRKQMPPPPPCPGKEL
FDDPSYVNVQNLDKARQAGGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPTQAVAMAE
QLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGV
VRTKDHRFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccaccccaccggaggagctgccttccccatcagcttcg
tccctggggcccatcctgccacctctgcctggggatgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaacccagccggggggcgcccggggcca
aagggggagccaggaagggcagcggaggatggggagggcatcgtagggnccatgccagac
tcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgcagg
actcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagctttgtc
aataagcccacgcggggctggctgcatcccaacgacaaagtcatgggaccaggggtttcc
tacctggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccttggacttc
aacacccgcacccaggtcaccagggaggccatcagtctggtgtgtgaggctgtgcccggt
gccaagggggcaacaaggaggagaaagccctgtagccgcccgctcagttccatcctgggg
aggagtaacctgaaatttgccgggatgcccatcactctcaccgtctccaccagcagcctc
aacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcagtctatctcg
tttgcgtccggtggggacccggacacagccgagtacgtcgcctatgttgccaaagacccg
gtgaatcagagagcctgtcacatcctggagtgtcccgaagggctcgctcaggatgtcatt
agcaccatcggccaggccttcgagttgcgcttcaaacaatacctcaggaacccgcccaag
ctggtcacccctcacgacaggatggccggttttgatggctcagcttgggatgaggaggag
gaagagccacctgaccaccagtactataatgatttcccggggaaggaaccccctcttggg
ggagtggtggacatgaggcttcgggaaggagcccccctgggggctgctcggtccactcca
cctggtgtccagacccccagccacctgggagcaacgctgcctgtggggcagcctgtcggg
ggagacccagaaattcgcaaacagatgccacctccaccaccctgcccaggtaaagagctc
tttgatgatccttcctatgtcaacgtccagaacctagacaaggcccggcaagcagggggt
ggggctgggccccccaatcctgccatcaatggcagcgcgcccagagacctctttgacatg
aagcccttcgaagatgcccttcgggtgcctccacctacccaggccgtggccatggctgag
cagctccgaggggagccctggttccacgggaagctgagccggcgggaggctgaagcactg
ctgcagctcaacggggacttcctggtgcgggagagcacgaccacgccgggccagtacgtg
ctcaccggcttgcagagtgggcagcccaagcacctgctgctggtggaccctgagggcgtg
gttcggacaaaggatcaccgctttgagagtgtcagccacctcatcagctaccatgtggac
aatcacttgcccatcatctctgcaggcagtgaactatgtctacagcagcccgttgagcgg
aagctgtga

KEGG   Ursus maritimus (polar bear): 103676722
Entry
103676722         CDS       T03271                                 

Gene name
SHC4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04510  Focal adhesion
umr04650  Natural killer cell mediated cytotoxicity
umr04722  Neurotrophin signaling pathway
umr04910  Insulin signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05100  Bacterial invasion of epithelial cells
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05220  Chronic myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103676722 (SHC4)
   04014 Ras signaling pathway
    103676722 (SHC4)
   04072 Phospholipase D signaling pathway
    103676722 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676722 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103676722 (SHC4)
   04062 Chemokine signaling pathway
    103676722 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676722 (SHC4)
   04915 Estrogen signaling pathway
    103676722 (SHC4)
   04917 Prolactin signaling pathway
    103676722 (SHC4)
   04926 Relaxin signaling pathway
    103676722 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    103676722 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103676722 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103676722 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103676722 (SHC4)
   05226 Gastric cancer
    103676722 (SHC4)
   05214 Glioma
    103676722 (SHC4)
   05220 Chronic myeloid leukemia
    103676722 (SHC4)
   05224 Breast cancer
    103676722 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    103676722 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103676722 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676722 (SHC4)
   01522 Endocrine resistance
    103676722 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 103676722
NCBI-ProteinID: XP_008704158
UniProt: A0A384DAU7
LinkDB
Position
Un
AA seq 630 aa
MRKRGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDESSPGGSVGNKGSPQPPY
PTLAPHLPAEDATLASQDSPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPTSPETGLNRAGTAPPPQPDLVGHRATVLTPDACPLPGPGELTPGSRQDRH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEM
PVDGPTEEREDHEYYNEIPGKQPPTGGVSDVRIKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQNRAIGNAPERGVQSHRDASLMKHACRVDFFNDPCYINTQALQSTLGSAPD
QSSAHPPGSPWHREKAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKENNPGLLHCNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgaaaacgcggtcaggatagcctggcaggacttgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgttttcggaatgagtccatcacgtcc
ttggacgaaagcagccctggaggctcggtggggaacaagggctcgcctcagcctccctac
cccaccctggcacctcacctgccggccgaagatgccaccttggcgtcccaggacagcccc
accccactgtgcaccttgatccctcgcatggccagcgtgaagctggccaacccagccacc
ctgctgagtctgaaaaacttttgcttgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccggctcccagcagcccaacttcccctgagaccggtctaaatagggct
gggaccgcacctccgccgcagccagacctggtggggcacagggcgactgtcttaactccc
gatgcctgtccccttcctggccctggggagctgaccccagggagcaggcaggacaggcac
tttctgcagcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaagtactgcagtcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaatcagtcgcctgtgtgaagctgtttctggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatattaaactgaccatctcaacatgcagcctcacgttgatgaatattgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatactg
gaatgccgcagcgggatggcccaagatgtcataagcaccatagggcaggcttttgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttgtgaaagtgaggagatg
cccgttgatggtcccactgaggaaagagaagaccacgagtactacaacgaaatccccggg
aagcagccaccaacaggtggtgtttctgacgtgcggatcaaagtccaagccacagagcaa
atggcttactgccccatacggtgtgagaagttgtgctatttgcctgggaactccaagtgc
agcagcgtgtacgagaactgtttagaacaaaaccgggcaataggtaatgcaccggagaga
ggagtgcagtcccatcgagatgcctcattaatgaagcacgcctgtcgagtggatttcttc
aatgacccctgctacataaatacacaggctcttcagagtacacttggctctgccccagat
caaagctcagctcaccccccggggagcccgtggcaccgtgaaaaagcaccagaaaccgtt
cagccaggtgccacggcccagcctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccatggcaaactgagcaggaaggcagcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatctcctggccagtatgtgcta
agtggcctacagggaggccaggcaaagcatcttctcctggtggatcctgaaggcaaggtc
aggaccaaggatcatgtatttgataacgtcggtcaccttatcagataccacatggataac
agtttgccaatcatctcttccggaagcgaagtaagcctcaaacaaccagtgagaaaagaa
aataatccaggacttttgcattgcaacaaatga

KEGG   Ursus maritimus (polar bear): 103681753
Entry
103681753         CDS       T03271                                 

Gene name
SHC2
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04650  Natural killer cell mediated cytotoxicity
umr04722  Neurotrophin signaling pathway
umr04910  Insulin signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05100  Bacterial invasion of epithelial cells
umr05214  Glioma
umr05220  Chronic myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103681753 (SHC2)
   04014 Ras signaling pathway
    103681753 (SHC2)
   04370 VEGF signaling pathway
    103681753 (SHC2)
   04072 Phospholipase D signaling pathway
    103681753 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103681753 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103681753 (SHC2)
   04062 Chemokine signaling pathway
    103681753 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103681753 (SHC2)
   04915 Estrogen signaling pathway
    103681753 (SHC2)
   04917 Prolactin signaling pathway
    103681753 (SHC2)
   04926 Relaxin signaling pathway
    103681753 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    103681753 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103681753 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103681753 (SHC2)
   05226 Gastric cancer
    103681753 (SHC2)
   05214 Glioma
    103681753 (SHC2)
   05220 Chronic myeloid leukemia
    103681753 (SHC2)
   05224 Breast cancer
    103681753 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    103681753 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103681753 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103681753 (SHC2)
   01522 Endocrine resistance
    103681753 (SHC2)
SSDB
Motif
Pfam: PID
Other DBs
NCBI-GeneID: 103681753
NCBI-ProteinID: XP_008709558
UniProt: A0A384DRE8
LinkDB
Position
Un
AA seq 413 aa
MGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKRKAPNKALASILGKSNLRF
AGMSIAVSISTDGLNLSVPATRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRGA
IGAIAGPEGKDGAMLRAPHPSPAAPDSGCSSAEEPGSESPRPGSSHAPGKAQATRPWHTL
GGPPILSPPEYWGSCLCSRLLSVPRLARPEESAWGDEEEMEHNYYNSIPGKEPPLGGLVD
SRLTLTQPCALGALGALGQGASPAQRDTHSLPWDLGPSGTGPPGDGYVQADAKGPRDYED
HLYVNTQGLDAPEALQLEDSPKKDLFDMRPFEDALKLHECSVGADTAVAPLPLEDQLKPL
AVLTLRPLALQVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgggctgcattgaagtcctccgctccatgcgctctctggattttaacacccgcacccag
gtgaccagggaagccatcaaccggctccatgaggcagtgcccggcgtccggggctcctgg
aagaggaaggcccccaacaaagcgctggcctccatcctgggcaagagcaacctgcgtttc
gcgggcatgagtatcgctgtgagcatctccacggacggcctcaacctctctgtgcctgcc
acacgccagatcattgccaaccaccacatgcagtccatctccttcgcatcgggtggtgac
acggacatgacggattacgtggcctatgtagccaaggatcccatcaaccagagaggagcc
ataggtgccattgcggggccagagggcaaggacggtgcaatgctgagggcaccccaccct
agccccgcggcaccggactctgggtgcagctcggccgaggagccagggtcagagtcccct
aggcctggctcgtcccatgcacctggcaaagctcaagccacaaggccttggcacactctt
ggggggccccccattctctctccccccgagtactggggttcctgcctgtgctcccgcttg
ctttctgtccccaggctggccaggccagaggagtcggcctggggggacgaggaagaaatg
gaacacaattactacaacagcatcccggggaaggagccgcccctgggtgggctggtggac
tccaggctcaccctaactcagccctgtgccctcggggccctcggagccctcggccagggg
gcatctcctgctcaaagggacacgcacagcctgccatgggacctgggcccgtcaggtact
ggcccaccgggggatggctacgtgcaggctgacgccaagggccccagagactacgaggac
cacctgtatgtcaacacacagggtctggacgccccggaggccctgcagctggaggacagc
cccaagaaggatctgtttgacatgcgacccttcgaggatgctctcaagctgcacgaatgt
tctgtgggggcagacacggcggtagcgccccttcccttggaggaccagctcaagcccctg
gcggtgctcacgctgaggcctctggccctgcaggtgcggaccaaggacgtgctctttgag
agtatcagccatctgatcgactaccacctgcagaacgggcagcccatcgtggccgccgaa
agcgagctgcatctgcgcggtgtggtcaaacgtgagccctga

DBGET integrated database retrieval system