Ursus maritimus (polar bear): 103663281 Help Entry 103663281         CDS       T03271                                  Gene name GNAQ Definition (RefSeq) G protein subunit alpha q   KO K04634   guanine nucleotide-binding protein G(q) subunit alpha Organism umr  Ursus maritimus (polar bear) Pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04022   cGMP-PKG signaling pathway umr04062   Chemokine signaling pathway umr04071   Sphingolipid signaling pathway umr04261   Adrenergic signaling in cardiomyocytes umr04270   Vascular smooth muscle contraction umr04371   Apelin signaling pathway umr04540   Gap junction umr04611   Platelet activation umr04713   Circadian entrainment umr04720   Long-term potentiation umr04723   Retrograde endocannabinoid signaling umr04724   Glutamatergic synapse umr04725   Cholinergic synapse umr04726   Serotonergic synapse umr04728   Dopaminergic synapse umr04730   Long-term depression umr04750   Inflammatory mediator regulation of TRP channels umr04911   Insulin secretion umr04912   GnRH signaling pathway umr04915   Estrogen signaling pathway umr04916   Melanogenesis umr04918   Thyroid hormone synthesis umr04921   Oxytocin signaling pathway umr04922   Glucagon signaling pathway umr04924   Renin secretion umr04925   Aldosterone synthesis and secretion umr04927   Cortisol synthesis and secretion umr04928   Parathyroid hormone synthesis, secretion and action umr04929   GnRH secretion umr04934   Cushing syndrome umr04935   Growth hormone synthesis, secretion and action umr04961   Endocrine and other factor-regulated calcium reabsorption umr04970   Salivary secretion umr04971   Gastric acid secretion umr04972   Pancreatic secretion umr05010   Alzheimer disease umr05016   Huntington disease umr05017   Spinocerebellar ataxia umr05022   Pathways of neurodegeneration - multiple diseases umr05135   Yersinia infection umr05142   Chagas disease umr05143   African trypanosomiasis umr05146   Amoebiasis umr05163   Human cytomegalovirus infection umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103663281 (GNAQ)    04371 Apelin signaling pathway     103663281 (GNAQ)    04020 Calcium signaling pathway     103663281 (GNAQ)    04071 Sphingolipid signaling pathway     103663281 (GNAQ)    04022 cGMP-PKG signaling pathway     103663281 (GNAQ)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     103663281 (GNAQ)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103663281 (GNAQ)    04062 Chemokine signaling pathway     103663281 (GNAQ)   09152 Endocrine system    04911 Insulin secretion     103663281 (GNAQ)    04922 Glucagon signaling pathway     103663281 (GNAQ)    04929 GnRH secretion     103663281 (GNAQ)    04912 GnRH signaling pathway     103663281 (GNAQ)    04915 Estrogen signaling pathway     103663281 (GNAQ)    04921 Oxytocin signaling pathway     103663281 (GNAQ)    04935 Growth hormone synthesis, secretion and action     103663281 (GNAQ)    04918 Thyroid hormone synthesis     103663281 (GNAQ)    04928 Parathyroid hormone synthesis, secretion and action     103663281 (GNAQ)    04916 Melanogenesis     103663281 (GNAQ)    04924 Renin secretion     103663281 (GNAQ)    04925 Aldosterone synthesis and secretion     103663281 (GNAQ)    04927 Cortisol synthesis and secretion     103663281 (GNAQ)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103663281 (GNAQ)    04270 Vascular smooth muscle contraction     103663281 (GNAQ)   09154 Digestive system    04970 Salivary secretion     103663281 (GNAQ)    04971 Gastric acid secretion     103663281 (GNAQ)    04972 Pancreatic secretion     103663281 (GNAQ)   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     103663281 (GNAQ)   09156 Nervous system    04724 Glutamatergic synapse     103663281 (GNAQ)    04725 Cholinergic synapse     103663281 (GNAQ)    04728 Dopaminergic synapse     103663281 (GNAQ)    04726 Serotonergic synapse     103663281 (GNAQ)    04720 Long-term potentiation     103663281 (GNAQ)    04730 Long-term depression     103663281 (GNAQ)    04723 Retrograde endocannabinoid signaling     103663281 (GNAQ)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103663281 (GNAQ)   09159 Environmental adaptation    04713 Circadian entrainment     103663281 (GNAQ)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103663281 (GNAQ)   09164 Neurodegenerative disease    05010 Alzheimer disease     103663281 (GNAQ)    05016 Huntington disease     103663281 (GNAQ)    05017 Spinocerebellar ataxia     103663281 (GNAQ)    05022 Pathways of neurodegeneration - multiple diseases     103663281 (GNAQ)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103663281 (GNAQ)   09171 Infectious disease: bacterial    05135 Yersinia infection     103663281 (GNAQ)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103663281 (GNAQ)    05163 Human cytomegalovirus infection     103663281 (GNAQ)   09174 Infectious disease: parasitic    05146 Amoebiasis     103663281 (GNAQ)    05142 Chagas disease     103663281 (GNAQ)    05143 African trypanosomiasis     103663281 (GNAQ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103663281 (GNAQ)    04031 GTP-binding proteins [BR:umr04031]     103663281 (GNAQ) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103663281 (GNAQ) GTP-binding proteins [BR:umr04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 3 (Gq/11) [OT]     103663281 (GNAQ) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Motif Other DBs NCBI-GeneID:  103663281 NCBI-ProteinID:  XP_008689196 UniProt:  A0A384C2T8 LinkDB All DBs Position Un AA seq 324 aa AA seqDB search MTSFAVVHLAGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMD TLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSD STKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRK WIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNK KDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTE NIRFVFAAVKDTILQLNLKEYNLV NT seq 975 nt NT seq  +upstreamnt  +downstreamnt atgacatcttttgctgttgtccatcttgcagggacaggagagagtggcaagagtacgttt atcaagcagatgagaatcatccacgggtcgggctactctgacgaagacaaaaggggcttc accaagctggtgtatcagaacatcttcacggccatgcaggccatgatcagagccatggac acgctcaagatcccctacaagtacgagcacaataaggctcatgcacagttagttcgagaa gttgacgtggagaaggtgtctgcttttgagaatccatacgtagatgcaataaagagttta tggaatgatcctggaatccaggaatgctacgatagacgacgagagtatcagttgtctgac tctaccaaatactatcttaatgacttggaccgcgttgctgaccccgcctacctgcctacg caacaagatgtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgac ttacaaagtgtcattttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaa tggatacactgctttgaaaatgtcacctctatcatgtttctagtagcgcttagtgaatat gatcaagttctcgtggagtcggacaatgagaaccgaatggaggaaagcaaagcactcttt agaacaattatcacatatccctggttccagaactcctcggttattctattcttgaacaag aaagatcttctagaggagaaaattatgtattcccacctagttgactacttcccggaatat gatggaccccagagagatgcccaggcggctcgagaattcatcctgaagatgttcgtggac ctgaacccagacagtgacaaaattatctactcccacttcacgtgcgccacagacaccgag aacatccgctttgtctttgccgccgtcaaggacaccatcctccagctgaacctgaaggag tacaatctggtctga

Ursus maritimus (polar bear): 103681813 Help Entry 103681813         CDS       T03271                                  Gene name GNA11 Definition (RefSeq) G protein subunit alpha 11   KO K04635   guanine nucleotide-binding protein subunit alpha-11 Organism umr  Ursus maritimus (polar bear) Pathway umr04020   Calcium signaling pathway umr04022   cGMP-PKG signaling pathway umr04270   Vascular smooth muscle contraction umr04540   Gap junction umr04725   Cholinergic synapse umr04730   Long-term depression umr04911   Insulin secretion umr04912   GnRH signaling pathway umr04925   Aldosterone synthesis and secretion umr04927   Cortisol synthesis and secretion umr04928   Parathyroid hormone synthesis, secretion and action umr04929   GnRH secretion umr04934   Cushing syndrome umr04935   Growth hormone synthesis, secretion and action umr05142   Chagas disease umr05146   Amoebiasis umr05163   Human cytomegalovirus infection umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04020 Calcium signaling pathway     103681813 (GNA11)    04022 cGMP-PKG signaling pathway     103681813 (GNA11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     103681813 (GNA11)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     103681813 (GNA11)    04929 GnRH secretion     103681813 (GNA11)    04912 GnRH signaling pathway     103681813 (GNA11)    04935 Growth hormone synthesis, secretion and action     103681813 (GNA11)    04928 Parathyroid hormone synthesis, secretion and action     103681813 (GNA11)    04925 Aldosterone synthesis and secretion     103681813 (GNA11)    04927 Cortisol synthesis and secretion     103681813 (GNA11)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103681813 (GNA11)   09156 Nervous system    04725 Cholinergic synapse     103681813 (GNA11)    04730 Long-term depression     103681813 (GNA11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103681813 (GNA11)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103681813 (GNA11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103681813 (GNA11)    05163 Human cytomegalovirus infection     103681813 (GNA11)   09174 Infectious disease: parasitic    05146 Amoebiasis     103681813 (GNA11)    05142 Chagas disease     103681813 (GNA11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103681813 (GNA11)    04031 GTP-binding proteins [BR:umr04031]     103681813 (GNA11) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103681813 (GNA11)   Exosomal proteins of melanoma cells    103681813 (GNA11) GTP-binding proteins [BR:umr04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 3 (Gq/11) [OT]     103681813 (GNA11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA Motif Other DBs NCBI-GeneID:  103681813 NCBI-ProteinID:  XP_008709617 UniProt:  A0A384DRC6 LinkDB All DBs Position Un AA seq 395 aa AA seqDB search MHVRVNVCTRMCALRGGVHASRRLQSTCLLRLEEPLPAGPSPQSCPRVLAAWRLSPLPAV PDSVERAAGVGSDTPGPACACCKGVRLPTSEGTRPRFVGMKHPTVAVTVCGVSLLRGQAR ERPAAQETLGGVVPGLELERSRRLLTLSCGAGMRAWWPCGPSPDGFPADLLILLIPCDRD LFLGVSHSTPEGCPGPTPPPSPWLSLPSSQANALLIRDVDVEKVTTFEHRYVHAIKTLWD DPGIQECYDRRREYQLSDSAKYYLADVDRIATSGYLPTQQDVLRVRVPTTGIIEYPFDLE NIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRT IITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYF NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt atgcatgtgcgtgtgaacgtgtgcacacgcatgtgtgcattgcgtgggggcgtgcacgct agcaggaggttgcagagcacgtgtctgctgcggctggaggagccacttcctgccgggccc tctccccagagctgcccgcgcgtccttgcggcttggcggctgtccccgctcccggcggtg ccagacagtgtggagcgagctgctggtgttggaagtgacacccccggtccagcctgcgct tgctgcaagggggtccgtcttcccacttcggaggggacgcggccgaggtttgtgggcatg aagcaccctacagttgccgtcactgtgtgtggggtgagcctgctgaggggacaggctcgg gagaggccggcggcgcaggagaccctgggcggggtggtgccggggctggagctggagcgg agcagacggctgctcaccctctcctgcggagctgggatgagggcgtggtggccctgtggc ccctctccggatggctttcccgctgacttgctgatccttctgatcccttgcgaccgagat ctgtttttgggggtttctcattcaaccccagaaggttgccctgggccgacgcccccgccg agcccatggctctccctgccctcgtcgcaggccaacgcgctcctgatccgcgacgtggat gtggagaaggtgacgacattcgagcaccgctacgtgcacgccatcaagaccctgtgggat gaccccggcatccaggagtgctacgaccggaggcgggaatatcagctctcggactccgcc aagtactacctggccgacgtggaccgcatcgccacctcaggctacctgcccacccagcag gacgtgctgcgggtccgtgtgcccaccaccggcatcattgagtaccctttcgacctggag aacatcatcttcaggatggtggacgtgggaggacagaggtcagagcggaggaagtggatc cactgctttgagaacgtgacgtccatcatgttcctcgttgccctgagtgaatacgaccaa gtgctggtggagtcggacaacgagaaccgcatggaggagagcaaagccctcttccggacc atcatcacctacccctggttccagaactcctctgtcatcctcttcctcaacaagaaggac ctgctggaggacaagatcttgcactcccacctggtggactacttc

DBGET integrated database retrieval system