KEGG   Ursus maritimus (polar bear): 103663281
Entry
103663281         CDS       T03271                                 

Gene name
GNAQ
Definition
(RefSeq) G protein subunit alpha q
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05135  Yersinia infection
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103663281 (GNAQ)
   04371 Apelin signaling pathway
    103663281 (GNAQ)
   04020 Calcium signaling pathway
    103663281 (GNAQ)
   04071 Sphingolipid signaling pathway
    103663281 (GNAQ)
   04022 cGMP-PKG signaling pathway
    103663281 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103663281 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103663281 (GNAQ)
   04062 Chemokine signaling pathway
    103663281 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    103663281 (GNAQ)
   04922 Glucagon signaling pathway
    103663281 (GNAQ)
   04929 GnRH secretion
    103663281 (GNAQ)
   04912 GnRH signaling pathway
    103663281 (GNAQ)
   04915 Estrogen signaling pathway
    103663281 (GNAQ)
   04921 Oxytocin signaling pathway
    103663281 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    103663281 (GNAQ)
   04918 Thyroid hormone synthesis
    103663281 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    103663281 (GNAQ)
   04916 Melanogenesis
    103663281 (GNAQ)
   04924 Renin secretion
    103663281 (GNAQ)
   04925 Aldosterone synthesis and secretion
    103663281 (GNAQ)
   04927 Cortisol synthesis and secretion
    103663281 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103663281 (GNAQ)
   04270 Vascular smooth muscle contraction
    103663281 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    103663281 (GNAQ)
   04971 Gastric acid secretion
    103663281 (GNAQ)
   04972 Pancreatic secretion
    103663281 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103663281 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    103663281 (GNAQ)
   04725 Cholinergic synapse
    103663281 (GNAQ)
   04728 Dopaminergic synapse
    103663281 (GNAQ)
   04726 Serotonergic synapse
    103663281 (GNAQ)
   04720 Long-term potentiation
    103663281 (GNAQ)
   04730 Long-term depression
    103663281 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    103663281 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103663281 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103663281 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663281 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103663281 (GNAQ)
   05016 Huntington disease
    103663281 (GNAQ)
   05017 Spinocerebellar ataxia
    103663281 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    103663281 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103663281 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103663281 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103663281 (GNAQ)
   05163 Human cytomegalovirus infection
    103663281 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103663281 (GNAQ)
   05142 Chagas disease
    103663281 (GNAQ)
   05143 African trypanosomiasis
    103663281 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103663281 (GNAQ)
   04031 GTP-binding proteins [BR:umr04031]
    103663281 (GNAQ)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103663281 (GNAQ)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103663281 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 103663281
NCBI-ProteinID: XP_008689196
UniProt: A0A384C2T8
LinkDB
Position
Un
AA seq 324 aa
MTSFAVVHLAGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMD
TLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSD
STKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRK
WIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNK
KDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTE
NIRFVFAAVKDTILQLNLKEYNLV
NT seq 975 nt   +upstreamnt  +downstreamnt
atgacatcttttgctgttgtccatcttgcagggacaggagagagtggcaagagtacgttt
atcaagcagatgagaatcatccacgggtcgggctactctgacgaagacaaaaggggcttc
accaagctggtgtatcagaacatcttcacggccatgcaggccatgatcagagccatggac
acgctcaagatcccctacaagtacgagcacaataaggctcatgcacagttagttcgagaa
gttgacgtggagaaggtgtctgcttttgagaatccatacgtagatgcaataaagagttta
tggaatgatcctggaatccaggaatgctacgatagacgacgagagtatcagttgtctgac
tctaccaaatactatcttaatgacttggaccgcgttgctgaccccgcctacctgcctacg
caacaagatgtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgac
ttacaaagtgtcattttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaa
tggatacactgctttgaaaatgtcacctctatcatgtttctagtagcgcttagtgaatat
gatcaagttctcgtggagtcggacaatgagaaccgaatggaggaaagcaaagcactcttt
agaacaattatcacatatccctggttccagaactcctcggttattctattcttgaacaag
aaagatcttctagaggagaaaattatgtattcccacctagttgactacttcccggaatat
gatggaccccagagagatgcccaggcggctcgagaattcatcctgaagatgttcgtggac
ctgaacccagacagtgacaaaattatctactcccacttcacgtgcgccacagacaccgag
aacatccgctttgtctttgccgccgtcaaggacaccatcctccagctgaacctgaaggag
tacaatctggtctga

KEGG   Ursus maritimus (polar bear): 103681813
Entry
103681813         CDS       T03271                                 

Gene name
GNA11
Definition
(RefSeq) G protein subunit alpha 11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04270  Vascular smooth muscle contraction
umr04540  Gap junction
umr04725  Cholinergic synapse
umr04730  Long-term depression
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05142  Chagas disease
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103681813 (GNA11)
   04022 cGMP-PKG signaling pathway
    103681813 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103681813 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103681813 (GNA11)
   04929 GnRH secretion
    103681813 (GNA11)
   04912 GnRH signaling pathway
    103681813 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    103681813 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    103681813 (GNA11)
   04925 Aldosterone synthesis and secretion
    103681813 (GNA11)
   04927 Cortisol synthesis and secretion
    103681813 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103681813 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    103681813 (GNA11)
   04730 Long-term depression
    103681813 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103681813 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103681813 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103681813 (GNA11)
   05163 Human cytomegalovirus infection
    103681813 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103681813 (GNA11)
   05142 Chagas disease
    103681813 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103681813 (GNA11)
   04031 GTP-binding proteins [BR:umr04031]
    103681813 (GNA11)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103681813 (GNA11)
  Exosomal proteins of melanoma cells
   103681813 (GNA11)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103681813 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA
Other DBs
NCBI-GeneID: 103681813
NCBI-ProteinID: XP_008709617
UniProt: A0A384DRC6
LinkDB
Position
Un
AA seq 395 aa
MHVRVNVCTRMCALRGGVHASRRLQSTCLLRLEEPLPAGPSPQSCPRVLAAWRLSPLPAV
PDSVERAAGVGSDTPGPACACCKGVRLPTSEGTRPRFVGMKHPTVAVTVCGVSLLRGQAR
ERPAAQETLGGVVPGLELERSRRLLTLSCGAGMRAWWPCGPSPDGFPADLLILLIPCDRD
LFLGVSHSTPEGCPGPTPPPSPWLSLPSSQANALLIRDVDVEKVTTFEHRYVHAIKTLWD
DPGIQECYDRRREYQLSDSAKYYLADVDRIATSGYLPTQQDVLRVRVPTTGIIEYPFDLE
NIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRT
IITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYF
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcatgtgcgtgtgaacgtgtgcacacgcatgtgtgcattgcgtgggggcgtgcacgct
agcaggaggttgcagagcacgtgtctgctgcggctggaggagccacttcctgccgggccc
tctccccagagctgcccgcgcgtccttgcggcttggcggctgtccccgctcccggcggtg
ccagacagtgtggagcgagctgctggtgttggaagtgacacccccggtccagcctgcgct
tgctgcaagggggtccgtcttcccacttcggaggggacgcggccgaggtttgtgggcatg
aagcaccctacagttgccgtcactgtgtgtggggtgagcctgctgaggggacaggctcgg
gagaggccggcggcgcaggagaccctgggcggggtggtgccggggctggagctggagcgg
agcagacggctgctcaccctctcctgcggagctgggatgagggcgtggtggccctgtggc
ccctctccggatggctttcccgctgacttgctgatccttctgatcccttgcgaccgagat
ctgtttttgggggtttctcattcaaccccagaaggttgccctgggccgacgcccccgccg
agcccatggctctccctgccctcgtcgcaggccaacgcgctcctgatccgcgacgtggat
gtggagaaggtgacgacattcgagcaccgctacgtgcacgccatcaagaccctgtgggat
gaccccggcatccaggagtgctacgaccggaggcgggaatatcagctctcggactccgcc
aagtactacctggccgacgtggaccgcatcgccacctcaggctacctgcccacccagcag
gacgtgctgcgggtccgtgtgcccaccaccggcatcattgagtaccctttcgacctggag
aacatcatcttcaggatggtggacgtgggaggacagaggtcagagcggaggaagtggatc
cactgctttgagaacgtgacgtccatcatgttcctcgttgccctgagtgaatacgaccaa
gtgctggtggagtcggacaacgagaaccgcatggaggagagcaaagccctcttccggacc
atcatcacctacccctggttccagaactcctctgtcatcctcttcctcaacaagaaggac
ctgctggaggacaagatcttgcactcccacctggtggactacttc

DBGET integrated database retrieval system