KEGG   Ursus maritimus (polar bear): 103663562
Entry
103663562         CDS       T03271                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03460  Fanconi anemia pathway
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    103663562 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663562 (POLK)
   05202 Transcriptional misregulation in cancer
    103663562 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103663562 (POLK)
   05212 Pancreatic cancer
    103663562 (POLK)
   05225 Hepatocellular carcinoma
    103663562 (POLK)
   05226 Gastric cancer
    103663562 (POLK)
   05214 Glioma
    103663562 (POLK)
   05216 Thyroid cancer
    103663562 (POLK)
   05220 Chronic myeloid leukemia
    103663562 (POLK)
   05217 Basal cell carcinoma
    103663562 (POLK)
   05218 Melanoma
    103663562 (POLK)
   05213 Endometrial cancer
    103663562 (POLK)
   05224 Breast cancer
    103663562 (POLK)
   05222 Small cell lung cancer
    103663562 (POLK)
   05223 Non-small cell lung cancer
    103663562 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103663562 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:umr03400]
    103663562 (POLK)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     103663562 (POLK)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    103663562 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 103663562
NCBI-ProteinID: XP_008689503
UniProt: A0A384C3S9
LinkDB
Position
Un
AA seq 870 aa
MDSTKEKNGNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRDLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYYARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSTE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTGNSLENEKPGKEAHE
LSEHERSMSPLLFDDSPPGLHPQGIPLQVNSEEQSNPQMLQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKNLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHHFLHISLGLGSTHLERDGERKSMSVER
TFSEVSKPEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLRTEIDAEFPHPLRLRLMGIRLSSFPNEEDKKHQQRSIIGFLQAGNQTL
SAAGYILEKTDKDQFLKPLEISHKKSFFDKKRSERKWSHEDTFKCEAVDKQSLRTSHSFQ
VLKKKMNENLETSENSNHSQIFTCPICFREQRSISLEAFNKHVDACLDGSLISENSSVFP
CSHPSSTEINKKENVHPSFSLHEKQDYETHQKNSEISSVDCAELVETEDNPPEAESVGGL
SEKHRKEECPSLPSNSFNIEERCHNSSSTVSLEDTGSLSRLESSQPYLHEVITDQALVCP
VCNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKVNLANQPRESTKSTDNSGRVQKTATK
PKRPGLMTKYSASKKTKPNNPRHTLDVFFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggatagcaccaaggagaagaatggcaattacaaagatgatcttctgcttagggtggga
cttaatgataataaagccggaatggaaggattagataaagagaagattaacaaaattata
atggaagccacaaaagggtccagattttatggaaatgaactcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgggatctgagc
aatactatagtgcacattgacatggatgctttctatgcagctgtagaaatgagagacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgttgtctacttcaaat
tactacgcaaggaggtttggtgttcgcgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattattgtgcccccaaactttgacaaataccgagctgtgagtacagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcctgaggacaaaaggaag
tatttcatcaaaacagggaactctctagaaaatgagaaaccaggaaaagaagctcatgag
ctgagtgagcatgaacgatccatgtctccactactttttgatgatagtcctcctggtttg
cacccccaaggaattcctttacaagtgaactccgaagaacagagtaatcctcaaatgctc
caaaattcgattgtttttggcacatcagctgaagaagtggtaaaggaaattcgtttcaga
attgagcaaaaaacaacactgacagccagtgcagggattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattctccccaacagacaa
gctgtgatggacttcatcaagaacttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcgcttggaattattacttgtacagaactctaccaacagagg
gcattgctttctcttcttttctctgaaacatcttggcatcatttccttcatatttccctg
ggtctaggttcaacacacctggaaagggatggagaaaggaaaagcatgagtgttgagagg
acattcagtgaggtaagtaaaccagaagaacaatatagcttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaagaaggactaaagggtagaactgttaccattaaactg
aagaatgtaaactttgaagtaaaaactcgtgcatctacggtttcatctgttgtttctact
gcagaagaaatatttgctattgctaaagaattgctaagaacagaaattgatgccgaattt
ccacatcccttgagattaagacttatgggtatacggttatccagttttcccaatgaagaa
gacaaaaaacaccaacaaaggagcattattgggttcttacaggctggaaaccaaactctg
tcagctgctgggtatatactagagaaaactgacaaagatcagtttctaaaacctctagaa
atatctcataagaagagtttctttgataaaaagcgatcagaaaggaaatggagccacgaa
gacacatttaaatgtgaagctgtggataaacaaagtttacggacatcacattcatttcaa
gttttaaagaagaagatgaatgagaatttagaaacatcggagaattcaaatcactctcag
atatttacctgtccaatttgctttagggagcaaagaagcatcagtctggaagcctttaat
aaacatgtagatgcatgtcttgatggatctttgatcagtgaaaactccagtgtgttccca
tgttcacatccttcctctacagaaattaacaagaaagaaaatgtacatccttctttctca
ctccatgagaagcaggattatgaaacccatcagaagaattcagaaatcagttcagtagat
tgtgcagagctagtagagactgaagataatccacctgaagcagaaagtgtaggtggtcta
agtgaaaagcaccgcaaagaggaatgccctagtcttccaagcaactcatttaatattgag
gaacgttgtcacaattcttcctctactgtttcattggaagatactgggtcattaagtcga
ctagaatcctcccagccttatttacatgaagtgataacagaccaagctctagtttgtcct
gtttgtaacctagaacaaaagacttcagatcttaccctgttcaatgtgcatgtggatgta
tgcttaaataaaggcattatccaggaactgagaaaggataaagttaatctagctaaccaa
cccagagaaagcaccaaaagtactgataactcaggcagagtgcagaagactgcaacaaaa
ccaaaaaggccgggattgatgacaaagtactcagcatcaaagaaaacaaaaccgaacaat
cccagacatactcttgatgtattttttaaatga

DBGET integrated database retrieval system