KEGG   Ursus maritimus (polar bear): 103663617
Entry
103663617         CDS       T03271                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103663617 (PIK3R1)
   04014 Ras signaling pathway
    103663617 (PIK3R1)
   04015 Rap1 signaling pathway
    103663617 (PIK3R1)
   04370 VEGF signaling pathway
    103663617 (PIK3R1)
   04630 JAK-STAT signaling pathway
    103663617 (PIK3R1)
   04668 TNF signaling pathway
    103663617 (PIK3R1)
   04066 HIF-1 signaling pathway
    103663617 (PIK3R1)
   04068 FoxO signaling pathway
    103663617 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    103663617 (PIK3R1)
   04072 Phospholipase D signaling pathway
    103663617 (PIK3R1)
   04071 Sphingolipid signaling pathway
    103663617 (PIK3R1)
   04024 cAMP signaling pathway
    103663617 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    103663617 (PIK3R1)
   04152 AMPK signaling pathway
    103663617 (PIK3R1)
   04150 mTOR signaling pathway
    103663617 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103663617 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    103663617 (PIK3R1)
   04218 Cellular senescence
    103663617 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103663617 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103663617 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103663617 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103663617 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    103663617 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    103663617 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    103663617 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    103663617 (PIK3R1)
   04660 T cell receptor signaling pathway
    103663617 (PIK3R1)
   04662 B cell receptor signaling pathway
    103663617 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    103663617 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    103663617 (PIK3R1)
   04670 Leukocyte transendothelial migration
    103663617 (PIK3R1)
   04062 Chemokine signaling pathway
    103663617 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103663617 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    103663617 (PIK3R1)
   04929 GnRH secretion
    103663617 (PIK3R1)
   04915 Estrogen signaling pathway
    103663617 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    103663617 (PIK3R1)
   04917 Prolactin signaling pathway
    103663617 (PIK3R1)
   04926 Relaxin signaling pathway
    103663617 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    103663617 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    103663617 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103663617 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103663617 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    103663617 (PIK3R1)
   04722 Neurotrophin signaling pathway
    103663617 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103663617 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    103663617 (PIK3R1)
   04380 Osteoclast differentiation
    103663617 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    103663617 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    103663617 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663617 (PIK3R1)
   05206 MicroRNAs in cancer
    103663617 (PIK3R1)
   05205 Proteoglycans in cancer
    103663617 (PIK3R1)
   05203 Viral carcinogenesis
    103663617 (PIK3R1)
   05230 Central carbon metabolism in cancer
    103663617 (PIK3R1)
   05231 Choline metabolism in cancer
    103663617 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103663617 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103663617 (PIK3R1)
   05212 Pancreatic cancer
    103663617 (PIK3R1)
   05225 Hepatocellular carcinoma
    103663617 (PIK3R1)
   05226 Gastric cancer
    103663617 (PIK3R1)
   05214 Glioma
    103663617 (PIK3R1)
   05221 Acute myeloid leukemia
    103663617 (PIK3R1)
   05220 Chronic myeloid leukemia
    103663617 (PIK3R1)
   05218 Melanoma
    103663617 (PIK3R1)
   05211 Renal cell carcinoma
    103663617 (PIK3R1)
   05215 Prostate cancer
    103663617 (PIK3R1)
   05213 Endometrial cancer
    103663617 (PIK3R1)
   05224 Breast cancer
    103663617 (PIK3R1)
   05222 Small cell lung cancer
    103663617 (PIK3R1)
   05223 Non-small cell lung cancer
    103663617 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103663617 (PIK3R1)
   05017 Spinocerebellar ataxia
    103663617 (PIK3R1)
   05020 Prion disease
    103663617 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103663617 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103663617 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    103663617 (PIK3R1)
   04931 Insulin resistance
    103663617 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103663617 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103663617 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    103663617 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103663617 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    103663617 (PIK3R1)
   05161 Hepatitis B
    103663617 (PIK3R1)
   05160 Hepatitis C
    103663617 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    103663617 (PIK3R1)
   05164 Influenza A
    103663617 (PIK3R1)
   05162 Measles
    103663617 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    103663617 (PIK3R1)
   05163 Human cytomegalovirus infection
    103663617 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103663617 (PIK3R1)
   05169 Epstein-Barr virus infection
    103663617 (PIK3R1)
   05165 Human papillomavirus infection
    103663617 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103663617 (PIK3R1)
   05142 Chagas disease
    103663617 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103663617 (PIK3R1)
   01524 Platinum drug resistance
    103663617 (PIK3R1)
   01522 Endocrine resistance
    103663617 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103663617 (PIK3R1)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103663617 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 DUF4201 Laminin_I Mod_r Lant_dehydr_C PI_PP_I
Other DBs
NCBI-GeneID: 103663617
NCBI-ProteinID: XP_008689562
UniProt: A0A384C402
LinkDB
Position
Un
AA seq 725 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADGEQQQALALPDLA
EQFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDV
QVLGDAFKRYLLDLPNPVIPVAVYSEMIYLAQEVQSSEEYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLSQASSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNAQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgagcgctgtatgattacaaaaaggaacgagaagaa
gatattgacttgcacttgggtgatatcttgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggttataat
gaaaccaccggggaaagaggggactttccgggaacttatgttgaatatatcggaaggaaa
aaaatctctcctcccacaccaaagccccgaccacctcgaccccttcctgttgcaccaggt
tcttcgaaagctgaagcagacggtgaacaacagcaagctttggcccttccagatcttgca
gagcagtttgcccctcccgacattgctccgcctcttcttgtgaagctagtggaagccatt
gaaaagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagca
gaattacgacagcttcttgattgtgatgccgcctccgtggacttggaaatgatcgatgtg
caagttttaggagacgctttcaaacgctatcttttggacttaccgaatcctgtcattcca
gtggccgtttacagtgaaatgatttatttagcccaagaagtacaaagctctgaagagtat
atccagctgttgaagaagctcattagggcacctaacatacctcatcagtattggcttacg
cttcagtatttgctaaaacatttcttcaagctctctcaagcctccagcaagaatcttctg
aatgcaagagtactctctgaacttttcagtcctctgcttttcagattcccagcagccagc
tctgagaatactgaacacctcataaaagttatagaaattttaatctcaactgagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccacccaaacccactactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctca
agggaagaagtgaatgagaaacttcgagacacagctgacgggacctttttggtacgagac
gcatctaccaaaatgcatggtgactatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccactgaccttcaac
tctgtggttgaactaataaaccactaccggaacgagtctctagctcagtataaccccaaa
ctggacgtgaaattactttatccggtatccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtaggaaaaaaattacatgaatataatgctcaatttcaagaaaaa
agtcgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
agccaggaacggtacagcaaagaatacatagaaaaatttaaacgtgaaggcaatgagaaa
gaaatacaaaggattatgcataattatgagaagctaaagtcccgaatcagtgaaatcgtg
gacagcagacgacgactggaggaagacttgaagaagcaggcggctgagtaccgggagatt
gacaaacgcatgaacagcataaagccggacctcatccagctgagaaagacgagagaccaa
tacttgatgtggctgactcagaagggcgtccggcagaagaagctcaatgagtggctgggc
aacgagaacacggaggaccaatactcgctggtggaagatgatgaggatttgccgcaccac
gacgagaagacctggaacgtgggcagcagcaaccgcaacaaagcggagaacctactccga
gggaaacgagacggcaccttcctggtccgggagagcagtaaacagggctgctacgcctgc
tctgtcgtggtggacggcgaagtcaagcattgcgtcatcaacaaaacggccaccggctat
ggcttcgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaa
cacacctccctcgtgcagcacaatgactcgctcaacgtcacactagcctacccggtatat
gcacagcagaggcgatga

KEGG   Ursus maritimus (polar bear): 103666874
Entry
103666874         CDS       T03271                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103666874 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103666874 (PIK3CD)
   04014 Ras signaling pathway
    103666874 (PIK3CD)
   04015 Rap1 signaling pathway
    103666874 (PIK3CD)
   04370 VEGF signaling pathway
    103666874 (PIK3CD)
   04630 JAK-STAT signaling pathway
    103666874 (PIK3CD)
   04668 TNF signaling pathway
    103666874 (PIK3CD)
   04066 HIF-1 signaling pathway
    103666874 (PIK3CD)
   04068 FoxO signaling pathway
    103666874 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    103666874 (PIK3CD)
   04072 Phospholipase D signaling pathway
    103666874 (PIK3CD)
   04071 Sphingolipid signaling pathway
    103666874 (PIK3CD)
   04024 cAMP signaling pathway
    103666874 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    103666874 (PIK3CD)
   04152 AMPK signaling pathway
    103666874 (PIK3CD)
   04150 mTOR signaling pathway
    103666874 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103666874 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    103666874 (PIK3CD)
   04218 Cellular senescence
    103666874 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103666874 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    103666874 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103666874 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103666874 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    103666874 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    103666874 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    103666874 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    103666874 (PIK3CD)
   04660 T cell receptor signaling pathway
    103666874 (PIK3CD)
   04662 B cell receptor signaling pathway
    103666874 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    103666874 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    103666874 (PIK3CD)
   04670 Leukocyte transendothelial migration
    103666874 (PIK3CD)
   04062 Chemokine signaling pathway
    103666874 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103666874 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    103666874 (PIK3CD)
   04929 GnRH secretion
    103666874 (PIK3CD)
   04915 Estrogen signaling pathway
    103666874 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    103666874 (PIK3CD)
   04917 Prolactin signaling pathway
    103666874 (PIK3CD)
   04926 Relaxin signaling pathway
    103666874 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    103666874 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    103666874 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103666874 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103666874 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    103666874 (PIK3CD)
   04722 Neurotrophin signaling pathway
    103666874 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103666874 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    103666874 (PIK3CD)
   04380 Osteoclast differentiation
    103666874 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    103666874 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    103666874 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666874 (PIK3CD)
   05206 MicroRNAs in cancer
    103666874 (PIK3CD)
   05205 Proteoglycans in cancer
    103666874 (PIK3CD)
   05203 Viral carcinogenesis
    103666874 (PIK3CD)
   05230 Central carbon metabolism in cancer
    103666874 (PIK3CD)
   05231 Choline metabolism in cancer
    103666874 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103666874 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103666874 (PIK3CD)
   05212 Pancreatic cancer
    103666874 (PIK3CD)
   05225 Hepatocellular carcinoma
    103666874 (PIK3CD)
   05226 Gastric cancer
    103666874 (PIK3CD)
   05214 Glioma
    103666874 (PIK3CD)
   05221 Acute myeloid leukemia
    103666874 (PIK3CD)
   05220 Chronic myeloid leukemia
    103666874 (PIK3CD)
   05218 Melanoma
    103666874 (PIK3CD)
   05211 Renal cell carcinoma
    103666874 (PIK3CD)
   05215 Prostate cancer
    103666874 (PIK3CD)
   05213 Endometrial cancer
    103666874 (PIK3CD)
   05224 Breast cancer
    103666874 (PIK3CD)
   05222 Small cell lung cancer
    103666874 (PIK3CD)
   05223 Non-small cell lung cancer
    103666874 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103666874 (PIK3CD)
   05017 Spinocerebellar ataxia
    103666874 (PIK3CD)
   05020 Prion disease
    103666874 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103666874 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103666874 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    103666874 (PIK3CD)
   04931 Insulin resistance
    103666874 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103666874 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103666874 (PIK3CD)
   05135 Yersinia infection
    103666874 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    103666874 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103666874 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    103666874 (PIK3CD)
   05161 Hepatitis B
    103666874 (PIK3CD)
   05160 Hepatitis C
    103666874 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    103666874 (PIK3CD)
   05164 Influenza A
    103666874 (PIK3CD)
   05162 Measles
    103666874 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    103666874 (PIK3CD)
   05163 Human cytomegalovirus infection
    103666874 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666874 (PIK3CD)
   05169 Epstein-Barr virus infection
    103666874 (PIK3CD)
   05165 Human papillomavirus infection
    103666874 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103666874 (PIK3CD)
   05142 Chagas disease
    103666874 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103666874 (PIK3CD)
   01524 Platinum drug resistance
    103666874 (PIK3CD)
   01522 Endocrine resistance
    103666874 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103666874 (PIK3CD)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103666874 (PIK3CD)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103666874 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 103666874
NCBI-ProteinID: XP_008693177
UniProt: A0A384CEB4
LinkDB
Position
Un
AA seq 949 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRXXXXXXXXXXPVLRLVAREGDRVKKLVNSQIS
LLIGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSW
GAGTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPED
YTLQVNGRQEYLYGGYPLCQFQVSARSGRGPALLPSPEPWPGPEGHGELGLWPLLSAMRW
AFGGHSKSVPCGAALPSLQEVGGGEGSAGEAWKPSSLSLWSLEQPFCVELIQGSKVNADE
RMKCDQPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGECC
LYMWPSVPGPPRRKGEARGSGLRMVAFPSNPNTESAAALVICLPEVAPYPVYYPTLDKVS
PLAVQGLGGAGGRDVPGIYRVEAGDAVHRTARTGGSRRPPRPCQGWPGVRPASPVRRDDE
LFRYLLQLVQVLKYESYLDCELAKFLLARALANRKIGHFLFWHLRSEMHVPSVALRFGLI
MEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHVCMRQETYLEA
LSNVQSPLDPSTLLAEVCVLFLPRRCPDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGC
LSTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEF
TLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILT
YDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDI
QYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gccgttgacttcctgttgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgggcccagtatgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagacggccgagcagcaa
gagctggaggacgagcagcggcgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngccggtg
ctgcggctggtggcccgagagggcgacagggtgaagaagctggtcaattctcagatcagc
ctcctcatcggcaaaggcctccacgagttcgactccctgcatgacccagaagtgaacgcc
tttcgcaccaagatgcgccagttctgtgaggaggcggccgcccggcggcagcagctgggc
tgggaggcttggctacagtacagcttcccactgcagctggagccctcggcgcggagctgg
ggggccggcaccctgcgggtccccaaccgggccctcctggtcaacgtcaagttcgagggc
agcgaggagagcttcaccttccaggtgtccaccaaggacgtgccactggcgctgatggcg
tgcgcgctgcggaagaaggccaccgtgttccggcagcccctggtggagcagcccgaggac
tacacgctgcaggtgaacgggaggcaggagtacctgtacggcggctacccgctctgccag
ttccaggtaagcgcgcgctcggggaggggccctgcgctcctgccgtccccagagccctgg
ccaggcccggaggggcatggggagctgggcctttggcccctcttgagcgcgatgagatgg
gcctttgggggtcacagtaaaagtgtcccctgtggggctgctctccccagtcttcaggaa
gtgggtgggggcgaagggtcagcaggagaggcctggaagccttcctccttgtccctgtgg
tccctggagcagcctttctgcgtggagctgattcagggcagcaaagtgaatgccgatgag
cggatgaagtgtgaccagccccgcatggcccgtctctgctttgcactttacgccgtgatc
gagaaggccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatc
gcctgggccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgc
ctgtacatgtggccgtccgtcccaggtccgcccaggcggaagggagaggcgcgggggagc
gggctccggatggtggcattccccagtaaccccaacacggagagcgctgcggccctcgtc
atctgcctccccgaggtggccccctaccctgtgtactaccccaccctggacaaggtcagc
cccctcgccgtccagggtctgggaggagctggtgggagagatgttcctggcatctacagg
gtggaggccggggacgcggtgcacaggacggcccgcactggcgggagtcgcaggccccca
cggccctgccagggctggcccggggtgaggccggcctcccctgtccgcagggacgacgag
ctcttccggtacctgctgcagctggtgcaggtgctcaagtacgagtcctacctggactgc
gagctggccaagttcctgctggcccgggccctggccaaccgcaagatcggccacttcctc
ttctggcacctccgctccgagatgcacgtgccgtccgtggccctgcgcttcggcctcatc
atggaggcctactgccggggtagcacccaccacatgaaggtgctcatgaagcagggggag
gcgctgagcaaactgaaggccctgaatgactttgtcaaagtgagctcccagaagaccacc
aagccccagaccaaggagctgatgcacgtgtgcatgcgtcaggagacctacctggaggcc
ctttccaacgtgcagtccccgctggaccccagcaccctgctggctgaagtctgcgtgctt
ttccttccgcggcgctgcccagacctccgccaggacatgctgactctgcagatgatccag
ctcatggacgttctgtggaagcaggagggactggacctgaggatgaccccctacggctgc
ctctccaccggggaccgcactggcctcatcgaggtggtgcttcactcagacaccatcgcc
aacatccagttgaacaaaagcaacatggcggccacagctgccttcaacaaggatgccctg
ctcaactggctcaagtccaagaaccctggggaggccttggatcgagccatcgaggagttt
accctctcctgtgctggctactgtgtggccacttacgtgctgggcatcggagaccggcac
agcgacaacatcatgatccgcgagaacgggcagctcttccacattgatttcggccacttt
ctgggcaatttcaagaccaagtttggaatcaaccgtgagcgagtcccgttcatcctcacg
tatgactttgtgcacgtgatccagcaggggaaaacgaataacagtgagaaatttgaaagg
ttccggggttactgtgagcgagcctacaccatcctgaggcgccacgggctgctctttctc
cacctcttcgccctgatgcgggccgccggcctgcctgagctcagctgctccaaagacatc
cagtatctcaaggactctctggcgttgggaaagacggaggaggaggccctaaagcacttc
cgagtgaagttcaacgaagccctccgggagagctggaagaccaaagtgaactggctggcc
cacaatgtgtccaaagataacaggcaatag

KEGG   Ursus maritimus (polar bear): 103670766
Entry
103670766         CDS       T03271                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103670766 (PIK3R3)
   04014 Ras signaling pathway
    103670766 (PIK3R3)
   04015 Rap1 signaling pathway
    103670766 (PIK3R3)
   04370 VEGF signaling pathway
    103670766 (PIK3R3)
   04630 JAK-STAT signaling pathway
    103670766 (PIK3R3)
   04668 TNF signaling pathway
    103670766 (PIK3R3)
   04066 HIF-1 signaling pathway
    103670766 (PIK3R3)
   04068 FoxO signaling pathway
    103670766 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    103670766 (PIK3R3)
   04072 Phospholipase D signaling pathway
    103670766 (PIK3R3)
   04071 Sphingolipid signaling pathway
    103670766 (PIK3R3)
   04024 cAMP signaling pathway
    103670766 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    103670766 (PIK3R3)
   04152 AMPK signaling pathway
    103670766 (PIK3R3)
   04150 mTOR signaling pathway
    103670766 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103670766 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    103670766 (PIK3R3)
   04218 Cellular senescence
    103670766 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103670766 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103670766 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103670766 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103670766 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    103670766 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    103670766 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    103670766 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    103670766 (PIK3R3)
   04660 T cell receptor signaling pathway
    103670766 (PIK3R3)
   04662 B cell receptor signaling pathway
    103670766 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    103670766 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    103670766 (PIK3R3)
   04670 Leukocyte transendothelial migration
    103670766 (PIK3R3)
   04062 Chemokine signaling pathway
    103670766 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103670766 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    103670766 (PIK3R3)
   04929 GnRH secretion
    103670766 (PIK3R3)
   04915 Estrogen signaling pathway
    103670766 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    103670766 (PIK3R3)
   04917 Prolactin signaling pathway
    103670766 (PIK3R3)
   04926 Relaxin signaling pathway
    103670766 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    103670766 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    103670766 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103670766 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103670766 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    103670766 (PIK3R3)
   04722 Neurotrophin signaling pathway
    103670766 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103670766 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    103670766 (PIK3R3)
   04380 Osteoclast differentiation
    103670766 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    103670766 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    103670766 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670766 (PIK3R3)
   05206 MicroRNAs in cancer
    103670766 (PIK3R3)
   05205 Proteoglycans in cancer
    103670766 (PIK3R3)
   05203 Viral carcinogenesis
    103670766 (PIK3R3)
   05230 Central carbon metabolism in cancer
    103670766 (PIK3R3)
   05231 Choline metabolism in cancer
    103670766 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103670766 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103670766 (PIK3R3)
   05212 Pancreatic cancer
    103670766 (PIK3R3)
   05225 Hepatocellular carcinoma
    103670766 (PIK3R3)
   05226 Gastric cancer
    103670766 (PIK3R3)
   05214 Glioma
    103670766 (PIK3R3)
   05221 Acute myeloid leukemia
    103670766 (PIK3R3)
   05220 Chronic myeloid leukemia
    103670766 (PIK3R3)
   05218 Melanoma
    103670766 (PIK3R3)
   05211 Renal cell carcinoma
    103670766 (PIK3R3)
   05215 Prostate cancer
    103670766 (PIK3R3)
   05213 Endometrial cancer
    103670766 (PIK3R3)
   05224 Breast cancer
    103670766 (PIK3R3)
   05222 Small cell lung cancer
    103670766 (PIK3R3)
   05223 Non-small cell lung cancer
    103670766 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103670766 (PIK3R3)
   05017 Spinocerebellar ataxia
    103670766 (PIK3R3)
   05020 Prion disease
    103670766 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103670766 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103670766 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    103670766 (PIK3R3)
   04931 Insulin resistance
    103670766 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103670766 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103670766 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    103670766 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103670766 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    103670766 (PIK3R3)
   05161 Hepatitis B
    103670766 (PIK3R3)
   05160 Hepatitis C
    103670766 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    103670766 (PIK3R3)
   05164 Influenza A
    103670766 (PIK3R3)
   05162 Measles
    103670766 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    103670766 (PIK3R3)
   05163 Human cytomegalovirus infection
    103670766 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103670766 (PIK3R3)
   05169 Epstein-Barr virus infection
    103670766 (PIK3R3)
   05165 Human papillomavirus infection
    103670766 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103670766 (PIK3R3)
   05142 Chagas disease
    103670766 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103670766 (PIK3R3)
   01524 Platinum drug resistance
    103670766 (PIK3R3)
   01522 Endocrine resistance
    103670766 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103670766 (PIK3R3)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103670766 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 Exonuc_VII_L
Other DBs
NCBI-GeneID: 103670766
NCBI-ProteinID: XP_008697492
UniProt: A0A384CRN7
LinkDB
Position
Un
AA seq 480 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEEADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCRXRGSGKRGRSLAFFSYSFY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaagtaaatgacaaattacgg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggggattac
actttgactttgaggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgagtctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagacaacattgacgcagttggtaaaaaa
ctgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatatgag
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcaatgtcacacacaggaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaacgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagcatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggaggctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggag
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctcactgaaggagctggtgctgcattaccagcagacatccctcgttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataaagagggagtgggaagagaggtcgctctctagcatttttttcctacagtttttat
tag

KEGG   Ursus maritimus (polar bear): 103675162
Entry
103675162         CDS       T03271                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103675162 (PIK3R2)
   04014 Ras signaling pathway
    103675162 (PIK3R2)
   04015 Rap1 signaling pathway
    103675162 (PIK3R2)
   04370 VEGF signaling pathway
    103675162 (PIK3R2)
   04630 JAK-STAT signaling pathway
    103675162 (PIK3R2)
   04668 TNF signaling pathway
    103675162 (PIK3R2)
   04066 HIF-1 signaling pathway
    103675162 (PIK3R2)
   04068 FoxO signaling pathway
    103675162 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    103675162 (PIK3R2)
   04072 Phospholipase D signaling pathway
    103675162 (PIK3R2)
   04071 Sphingolipid signaling pathway
    103675162 (PIK3R2)
   04024 cAMP signaling pathway
    103675162 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    103675162 (PIK3R2)
   04152 AMPK signaling pathway
    103675162 (PIK3R2)
   04150 mTOR signaling pathway
    103675162 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103675162 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    103675162 (PIK3R2)
   04218 Cellular senescence
    103675162 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103675162 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103675162 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103675162 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103675162 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    103675162 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    103675162 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    103675162 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    103675162 (PIK3R2)
   04660 T cell receptor signaling pathway
    103675162 (PIK3R2)
   04662 B cell receptor signaling pathway
    103675162 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    103675162 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    103675162 (PIK3R2)
   04670 Leukocyte transendothelial migration
    103675162 (PIK3R2)
   04062 Chemokine signaling pathway
    103675162 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103675162 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    103675162 (PIK3R2)
   04929 GnRH secretion
    103675162 (PIK3R2)
   04915 Estrogen signaling pathway
    103675162 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    103675162 (PIK3R2)
   04917 Prolactin signaling pathway
    103675162 (PIK3R2)
   04926 Relaxin signaling pathway
    103675162 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    103675162 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    103675162 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103675162 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103675162 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    103675162 (PIK3R2)
   04722 Neurotrophin signaling pathway
    103675162 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103675162 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    103675162 (PIK3R2)
   04380 Osteoclast differentiation
    103675162 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    103675162 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    103675162 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675162 (PIK3R2)
   05206 MicroRNAs in cancer
    103675162 (PIK3R2)
   05205 Proteoglycans in cancer
    103675162 (PIK3R2)
   05203 Viral carcinogenesis
    103675162 (PIK3R2)
   05230 Central carbon metabolism in cancer
    103675162 (PIK3R2)
   05231 Choline metabolism in cancer
    103675162 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103675162 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103675162 (PIK3R2)
   05212 Pancreatic cancer
    103675162 (PIK3R2)
   05225 Hepatocellular carcinoma
    103675162 (PIK3R2)
   05226 Gastric cancer
    103675162 (PIK3R2)
   05214 Glioma
    103675162 (PIK3R2)
   05221 Acute myeloid leukemia
    103675162 (PIK3R2)
   05220 Chronic myeloid leukemia
    103675162 (PIK3R2)
   05218 Melanoma
    103675162 (PIK3R2)
   05211 Renal cell carcinoma
    103675162 (PIK3R2)
   05215 Prostate cancer
    103675162 (PIK3R2)
   05213 Endometrial cancer
    103675162 (PIK3R2)
   05224 Breast cancer
    103675162 (PIK3R2)
   05222 Small cell lung cancer
    103675162 (PIK3R2)
   05223 Non-small cell lung cancer
    103675162 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103675162 (PIK3R2)
   05017 Spinocerebellar ataxia
    103675162 (PIK3R2)
   05020 Prion disease
    103675162 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103675162 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103675162 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    103675162 (PIK3R2)
   04931 Insulin resistance
    103675162 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103675162 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103675162 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    103675162 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103675162 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    103675162 (PIK3R2)
   05161 Hepatitis B
    103675162 (PIK3R2)
   05160 Hepatitis C
    103675162 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    103675162 (PIK3R2)
   05164 Influenza A
    103675162 (PIK3R2)
   05162 Measles
    103675162 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    103675162 (PIK3R2)
   05163 Human cytomegalovirus infection
    103675162 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103675162 (PIK3R2)
   05169 Epstein-Barr virus infection
    103675162 (PIK3R2)
   05165 Human papillomavirus infection
    103675162 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103675162 (PIK3R2)
   05142 Chagas disease
    103675162 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103675162 (PIK3R2)
   01524 Platinum drug resistance
    103675162 (PIK3R2)
   01522 Endocrine resistance
    103675162 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103675162 (PIK3R2)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103675162 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH3_1 SH3_9 RhoGAP ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 103675162
NCBI-ProteinID: XP_008702405
UniProt: A0A384D6M6
LinkDB
Position
Un
AA seq 595 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSESLYRPELPAPPSAPGVQTQCRTRGTSGPTHCTPLPPR
TESSPDFPVLLVEKLLQEHLEEQEVAPPALPPKPPKAKPAPAGLANGGNPPSLQDAEWYW
GDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEP
LTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQ
YQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRRE
GNEKEMQRAALWLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRD
QYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEM
LSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTHGLLKTPHTPAQLLTSA
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggccggtgctgagggcttccagtaccgtgcactgtacccattccgccgggagcggcca
gaggacctggagctgctgccgggcgacgtgctggtggtgagccgggcagccctgcaggtg
ctgggcgtggctgagggcaacgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgagcgcacgcggcaacgaggcgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcctggccctcgtccacgtggcccccgcccactgcccgccaggccc
cgggatgggccccctgagccaggcctcacactccccgacctgccagagcagttctcccca
cctgatgtggctccccccatcctggtgaagctggtggaggccattgagcggacagggcta
gacagcgaatccctctacaggcctgagctgccagccccgccatctgccccaggcgtgcaa
acccagtgcaggacccggggcacgtcaggccctacccactgcactcccctcccccccagg
actgagtccagccctgacttcccggtgctgctggtggagaagttgcttcaggaacatctg
gaggagcaggaggtcgcacccccagctctgccgcctaaaccccccaaggcaaagcctgcc
cctgcaggcctggccaatggggggaatccaccctccctgcaggacgctgagtggtactgg
ggtgacatttccagggaggaggtgaacgagaagctccgggacacgcctgatggcaccttt
ctggtccgagatgcatctagcaagatccagggggagtacacactgaccctcaggaaaggc
gggaacaacaagctgattaaagtcttccaccgcgacgggcactatggcttctcagagcca
ctcaccttctgctccgttgtggacctcatcacccactaccgccatgagtcgctggcccag
tacaatgccaagctggacacccggctcctctaccccgtgtccaagtaccagcaggaccag
atcgtcaaggaggacagcgtggaggcggtgggtgcccagctcaaagtctaccaccagcag
taccaggacaagagccgcgagtatgaccagctctatgaggagtacacccgcacctcccag
gaactgcagatgaagcgcacggcaattgaggccttcaatgagaccatcaagatctttgaa
gagcagggccagacgcaagagaagtgtagcaaggaatacctggagcgcttccgacgtgag
ggtaatgagaaagagatgcagagagccgctctttggctcaagtctcgcatcgctgaaatc
catgagagccgcacaaagctggagcaggagctgcgggcacaggcctcagacaaccgggag
atcgacaagcgcatgaacagcctcaagccagatctcatgcagctgcgcaagatccgagac
cagtacctcgtgtggcttacccagaaaggcgcccggcagaagaagatcaacgagtggctg
gggatcaaaaatgagactgaggaccagtacgcgctgatggaggatgaggatgacctcccc
caccatgaggaacgcacgtggtatgtgggcaagatcaaccgaacacaggctgaggaaatg
ctgagtggcaagcgggatggtaccttcctcatccgggagagcagccagcggggctgctac
gcctgctctgtggtggtggacggcgacacgaagcactgcgtcatctaccgcacgcatggc
ctgctcaagaccccccatactcctgcccagcttctcaccagtgcctag

KEGG   Ursus maritimus (polar bear): 103676125
Entry
103676125         CDS       T03271                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103676125 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103676125 (PIK3CA)
   04014 Ras signaling pathway
    103676125 (PIK3CA)
   04015 Rap1 signaling pathway
    103676125 (PIK3CA)
   04370 VEGF signaling pathway
    103676125 (PIK3CA)
   04630 JAK-STAT signaling pathway
    103676125 (PIK3CA)
   04668 TNF signaling pathway
    103676125 (PIK3CA)
   04066 HIF-1 signaling pathway
    103676125 (PIK3CA)
   04068 FoxO signaling pathway
    103676125 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    103676125 (PIK3CA)
   04072 Phospholipase D signaling pathway
    103676125 (PIK3CA)
   04071 Sphingolipid signaling pathway
    103676125 (PIK3CA)
   04024 cAMP signaling pathway
    103676125 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    103676125 (PIK3CA)
   04152 AMPK signaling pathway
    103676125 (PIK3CA)
   04150 mTOR signaling pathway
    103676125 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103676125 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    103676125 (PIK3CA)
   04218 Cellular senescence
    103676125 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676125 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    103676125 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103676125 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103676125 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    103676125 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    103676125 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    103676125 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    103676125 (PIK3CA)
   04660 T cell receptor signaling pathway
    103676125 (PIK3CA)
   04662 B cell receptor signaling pathway
    103676125 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    103676125 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    103676125 (PIK3CA)
   04670 Leukocyte transendothelial migration
    103676125 (PIK3CA)
   04062 Chemokine signaling pathway
    103676125 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676125 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    103676125 (PIK3CA)
   04929 GnRH secretion
    103676125 (PIK3CA)
   04915 Estrogen signaling pathway
    103676125 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    103676125 (PIK3CA)
   04917 Prolactin signaling pathway
    103676125 (PIK3CA)
   04926 Relaxin signaling pathway
    103676125 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    103676125 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    103676125 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103676125 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103676125 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    103676125 (PIK3CA)
   04722 Neurotrophin signaling pathway
    103676125 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103676125 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    103676125 (PIK3CA)
   04380 Osteoclast differentiation
    103676125 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    103676125 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    103676125 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676125 (PIK3CA)
   05206 MicroRNAs in cancer
    103676125 (PIK3CA)
   05205 Proteoglycans in cancer
    103676125 (PIK3CA)
   05203 Viral carcinogenesis
    103676125 (PIK3CA)
   05230 Central carbon metabolism in cancer
    103676125 (PIK3CA)
   05231 Choline metabolism in cancer
    103676125 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103676125 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103676125 (PIK3CA)
   05212 Pancreatic cancer
    103676125 (PIK3CA)
   05225 Hepatocellular carcinoma
    103676125 (PIK3CA)
   05226 Gastric cancer
    103676125 (PIK3CA)
   05214 Glioma
    103676125 (PIK3CA)
   05221 Acute myeloid leukemia
    103676125 (PIK3CA)
   05220 Chronic myeloid leukemia
    103676125 (PIK3CA)
   05218 Melanoma
    103676125 (PIK3CA)
   05211 Renal cell carcinoma
    103676125 (PIK3CA)
   05215 Prostate cancer
    103676125 (PIK3CA)
   05213 Endometrial cancer
    103676125 (PIK3CA)
   05224 Breast cancer
    103676125 (PIK3CA)
   05222 Small cell lung cancer
    103676125 (PIK3CA)
   05223 Non-small cell lung cancer
    103676125 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103676125 (PIK3CA)
   05017 Spinocerebellar ataxia
    103676125 (PIK3CA)
   05020 Prion disease
    103676125 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676125 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103676125 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    103676125 (PIK3CA)
   04931 Insulin resistance
    103676125 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103676125 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103676125 (PIK3CA)
   05135 Yersinia infection
    103676125 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    103676125 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103676125 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    103676125 (PIK3CA)
   05161 Hepatitis B
    103676125 (PIK3CA)
   05160 Hepatitis C
    103676125 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    103676125 (PIK3CA)
   05164 Influenza A
    103676125 (PIK3CA)
   05162 Measles
    103676125 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    103676125 (PIK3CA)
   05163 Human cytomegalovirus infection
    103676125 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676125 (PIK3CA)
   05169 Epstein-Barr virus infection
    103676125 (PIK3CA)
   05165 Human papillomavirus infection
    103676125 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103676125 (PIK3CA)
   05142 Chagas disease
    103676125 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676125 (PIK3CA)
   01524 Platinum drug resistance
    103676125 (PIK3CA)
   01522 Endocrine resistance
    103676125 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103676125 (PIK3CA)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103676125 (PIK3CA)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103676125 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 103676125
NCBI-ProteinID: XP_008703530
UniProt: A0A384D9Q5
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFXLF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acactaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcctcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtgtctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactagaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaataccctctaagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccttcatattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattagagacattgacaagatctatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctaaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactttagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttnttttgttc
agcagtgtggtcaagttcccagatatgtcagtgattgaagagcatgccaactggtcggtg
tctcgggaagcaggatttagttattcccatgcaggactgagtaacagattagctagagac
aacgagttaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaacc
atccctgaaattctacccaaattgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgtaattacccagatcccatggttcgaggttttgctgtccggtgcttggaa
aaatacttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacggtg
agtcagcggtttggcctccttttggagtcctattgtcgtgcatgcgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctacaaggttttctgtctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttatcgaggtggtgcgaaactcgcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggcgctctgcagttcaacagccacacactccaccagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctactttcatactgggcattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtcattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Ursus maritimus (polar bear): 103678592
Entry
103678592         CDS       T03271                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05146  Amoebiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103678592 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103678592 (PIK3CB)
   04014 Ras signaling pathway
    103678592 (PIK3CB)
   04015 Rap1 signaling pathway
    103678592 (PIK3CB)
   04370 VEGF signaling pathway
    103678592 (PIK3CB)
   04630 JAK-STAT signaling pathway
    103678592 (PIK3CB)
   04668 TNF signaling pathway
    103678592 (PIK3CB)
   04066 HIF-1 signaling pathway
    103678592 (PIK3CB)
   04068 FoxO signaling pathway
    103678592 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    103678592 (PIK3CB)
   04072 Phospholipase D signaling pathway
    103678592 (PIK3CB)
   04071 Sphingolipid signaling pathway
    103678592 (PIK3CB)
   04024 cAMP signaling pathway
    103678592 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    103678592 (PIK3CB)
   04152 AMPK signaling pathway
    103678592 (PIK3CB)
   04150 mTOR signaling pathway
    103678592 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103678592 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    103678592 (PIK3CB)
   04218 Cellular senescence
    103678592 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103678592 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    103678592 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103678592 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103678592 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    103678592 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    103678592 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    103678592 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    103678592 (PIK3CB)
   04660 T cell receptor signaling pathway
    103678592 (PIK3CB)
   04662 B cell receptor signaling pathway
    103678592 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    103678592 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    103678592 (PIK3CB)
   04670 Leukocyte transendothelial migration
    103678592 (PIK3CB)
   04062 Chemokine signaling pathway
    103678592 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103678592 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    103678592 (PIK3CB)
   04929 GnRH secretion
    103678592 (PIK3CB)
   04915 Estrogen signaling pathway
    103678592 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    103678592 (PIK3CB)
   04917 Prolactin signaling pathway
    103678592 (PIK3CB)
   04926 Relaxin signaling pathway
    103678592 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    103678592 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    103678592 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103678592 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103678592 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    103678592 (PIK3CB)
   04722 Neurotrophin signaling pathway
    103678592 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103678592 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    103678592 (PIK3CB)
   04380 Osteoclast differentiation
    103678592 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    103678592 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    103678592 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103678592 (PIK3CB)
   05206 MicroRNAs in cancer
    103678592 (PIK3CB)
   05205 Proteoglycans in cancer
    103678592 (PIK3CB)
   05203 Viral carcinogenesis
    103678592 (PIK3CB)
   05230 Central carbon metabolism in cancer
    103678592 (PIK3CB)
   05231 Choline metabolism in cancer
    103678592 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103678592 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103678592 (PIK3CB)
   05212 Pancreatic cancer
    103678592 (PIK3CB)
   05225 Hepatocellular carcinoma
    103678592 (PIK3CB)
   05226 Gastric cancer
    103678592 (PIK3CB)
   05214 Glioma
    103678592 (PIK3CB)
   05221 Acute myeloid leukemia
    103678592 (PIK3CB)
   05220 Chronic myeloid leukemia
    103678592 (PIK3CB)
   05218 Melanoma
    103678592 (PIK3CB)
   05211 Renal cell carcinoma
    103678592 (PIK3CB)
   05215 Prostate cancer
    103678592 (PIK3CB)
   05213 Endometrial cancer
    103678592 (PIK3CB)
   05224 Breast cancer
    103678592 (PIK3CB)
   05222 Small cell lung cancer
    103678592 (PIK3CB)
   05223 Non-small cell lung cancer
    103678592 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103678592 (PIK3CB)
   05017 Spinocerebellar ataxia
    103678592 (PIK3CB)
   05020 Prion disease
    103678592 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103678592 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103678592 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    103678592 (PIK3CB)
   04931 Insulin resistance
    103678592 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103678592 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103678592 (PIK3CB)
   05135 Yersinia infection
    103678592 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    103678592 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103678592 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    103678592 (PIK3CB)
   05161 Hepatitis B
    103678592 (PIK3CB)
   05160 Hepatitis C
    103678592 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    103678592 (PIK3CB)
   05164 Influenza A
    103678592 (PIK3CB)
   05162 Measles
    103678592 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    103678592 (PIK3CB)
   05163 Human cytomegalovirus infection
    103678592 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103678592 (PIK3CB)
   05169 Epstein-Barr virus infection
    103678592 (PIK3CB)
   05165 Human papillomavirus infection
    103678592 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103678592 (PIK3CB)
   05142 Chagas disease
    103678592 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103678592 (PIK3CB)
   01524 Platinum drug resistance
    103678592 (PIK3CB)
   01522 Endocrine resistance
    103678592 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103678592 (PIK3CB)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103678592 (PIK3CB)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103678592 (PIK3CB)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 103678592
NCBI-ProteinID: XP_008706203
UniProt: A0A384DGQ5
LinkDB
Position
Un
AA seq 1067 aa
MCFNFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSVLENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPVSTVFILEAYCRGSVGHMKVLSKQVEALNKLKTLN
SLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDSKM
KPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLA
TGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTL
SCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYD
FIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQY
LKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggctgtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcacaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccctttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcccgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatc
cagtcgcttgtgggattgtcttggatggattggctaaagcagacgtatccaccagaacat
gaaccatcagtccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccagaaacgtttgactattcatgggaaagaagatgaa
gttagtccctatgactatgtgttgcaagtcagtgggagagtagaatacgtgtttggtgat
cacccactcattcagttccagtatatccggaactgtgtaatgaacaggaccttgccccat
tttatgcttgtggaatgttgcaagatcaagaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatcaaaccttcctcttcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtattggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctctgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccgctggaatttgatataaatacttgtgacctgccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtgaaaacgaaaaagtcgactaaaactatt
aatccctctaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcatgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttactattatcctcccttcgataagataatcgagaaggcagctgagattgcaagc
agtgacagtgctaatgtatccagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcagttgtgtgagaatgaaatggatcttatttggact
ttgcgacaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccttagagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcactggctaatcggaggatagggcaatttctattttggcaccttaggtca
gaagtgcatattcctgtaagtacagttttcatccttgaagcatactgccggggaagcgta
gggcacatgaaagtgctttctaagcaggttgaagccctcaataagttaaaaactttaaat
agtttaatcaaactgaatgcagtgaagctaaacagagccaaagggaaggaggccatgcat
acttgtttaaagcagaacgcttaccgggaagccctatcggacctgcagtcgcctctgaat
ccgtgtgttatcctctcagaactctatgttgaaaagtgtaaatacatggattccaaaatg
aagcctttgtggctcgtgtacaataacaaagtgtttggtgaggattcagttggagtgatt
tttaaaaatggtgatgatttacgacaagatatgttgacactccaaatgctgcgcttgatg
gatttactttggaaagaagctggtctggatcttcggatgctgccttatggctgtttagca
acaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaattgctgacatt
cagctgaacagtagcaacgtggctgctgcagcagccttcaacaaagatgcccttctgaac
tggcttaaagaatacaattctggggatgacctagaccgagccattgaggagtttaccttg
tcctgtgccggctactgtgtagcttcttatgtccttgggattggtgatagacatagtgac
aacatcatggtcaaaaaaaccggccagctcttccacattgactttggacatattcttgga
aatttcaagtctaaatttggcattaaaagggaacgggtgccttttattcttacctatgat
ttcattcatgtgattcaacaaggaaaaacaggaaacacagagaagtttggccgcttccgc
cagtgttgtgaggatgcatatctgattctacgacggcacgggaatctcttcatcactctt
tttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggatatacagtat
cttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaatttaagcaa
aaatttgatgaggcactcagggaaagctggactactaaagtaaactggatggcccacaca
gttcggaaagactacagatcttaa

DBGET integrated database retrieval system