KEGG   Ursus maritimus (polar bear): 103663709
Entry
103663709         CDS       T03271                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04390  Hippo signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103663709 (FGF1)
   04014 Ras signaling pathway
    103663709 (FGF1)
   04015 Rap1 signaling pathway
    103663709 (FGF1)
   04390 Hippo signaling pathway
    103663709 (FGF1)
   04151 PI3K-Akt signaling pathway
    103663709 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103663709 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663709 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103663709 (FGF1)
   05218 Melanoma
    103663709 (FGF1)
   05224 Breast cancer
    103663709 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103663709 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103663709 (FGF1)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103663709 (FGF1)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103663709 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103663709
NCBI-ProteinID: XP_008689675
UniProt: A0A384C499
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTANEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagtgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacagcaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system