KEGG   Ursus maritimus (polar bear): 103663781
Entry
103663781         CDS       T03271                                 

Gene name
EGR1
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04371  Apelin signaling pathway
umr04912  GnRH signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05020  Prion disease
umr05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103663781 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103663781 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    103663781 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    103663781 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103663781 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103663781 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103663781 (EGR1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    103663781 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 103663781
NCBI-ProteinID: XP_008689771
UniProt: A0A384C4G8
LinkDB
Position
Un
AA seq 534 aa
MQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGASEGSGGXDFLSGG
GGGGGGGSSGHSSGAFNPQGEAGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPP
ITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSAPSPAASSSSSASQSPP
LSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGAALQYPPPAYPAAKGGFQV
PMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNT
TYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQ
CRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKG
VVASSAATSLSSYPSQVATSYTSPVTTSYPSPATTSYPSPVPTSYSSPGSSTYPSPVHSG
FPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTTTFSPRTIEIC
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcagctgatgtccccgctgcagatctccgacccgttcggctcctttcctcactcgccc
accatggacaactatcctaagctggaggagatgatgctgctgagcaacggggctccccag
ttcctcggtgccgccggggcctcggagggcagcggcgggnnggactttttgagcgggggc
gggggaggtggagggggcggcagcagcggtcacagcagcggcgccttcaaccctcagggg
gaggcaggcgagcagccctacgagcacctgaccgcagagtcttttcctgatatctctctg
aataacgagaaggttctggtggagacaagttaccccagccaaaccacccggctgcccccc
atcacctacactggccgcttctctctggagcctgcacccaacagtggcaacaccttgtgg
cctgagcccctcttcagcctggtcagcggccttgtgagcatgaccaacccaccggccacc
tcatcttcagcaccatctccggcagcctcctcctcctcctctgcctctcagagcccaccc
ctgagctgtgcagtacagtccaatgacagcagccccatttactcagcggcaccgacgttc
cccacacctaacactgacatcttccctgagccacaaagccaggcctttccgggctccgcg
ggcgccgcgcttcagtacccgccgcctgcctatcctgctgccaagggtggcttccaggtc
cccatgatccctgactatctatttccacaacagcagggggacctgggcctgggcacccca
gaccagaagcccttccaaggcctggagagccgtacccagcagccttcactcactcccttg
tctaccatcaaggcctttgccacgcagtcgggctcccaggacttgaaggccctcaacacc
acctaccagtcccagctcatcaaacccagccgcatgcgcaagtaccccaaccggcccagc
aagacgccccctcacgaacgcccctacgcgtgcccggtggagtcctgtgaccgccgcttc
tcccgctcggatgagctcacccgccacattcgcatccataccggccagaagcccttccag
tgtcgcatctgcatgcgcaacttcagtcgcagtgaccatctcaccacccacatccgcacc
cacacaggcgagaagcccttcgcctgcgacatctgtgggagaaagtttgccaggagcgat
gaacgcaagaggcataccaagatccacttaaggcagaaggacaaaaaagcagacaaaggt
gttgtggcctcttctgccgccacctccctctcttcctacccgtcccaggtggctacctcc
tacacgtccccagttactacctcttatccgtccccagctaccacctcatatccatcacct
gtgcccacctcctactcctctcccggttcctcaacttacccatcccctgtgcacagtggc
ttcccctcaccctcagtggccaccacatactcctccgtcccccctgctttcccagcccag
gtcagcagcttcccttcctcagctgtcaccaactccttcagcgcctccacagggctttcg
gacatgacaacaaccttttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system