KEGG   Ursus maritimus (polar bear): 103663832
Entry
103663832         CDS       T03271                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04672  Intestinal immune network for IgA production
umr05140  Leishmaniasis
umr05200  Pathways in cancer
umr05310  Asthma
umr05320  Autoimmune thyroid disease
umr05321  Inflammatory bowel disease
umr05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103663832 (IL4)
   04151 PI3K-Akt signaling pathway
    103663832 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103663832 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103663832 (IL4)
   04660 T cell receptor signaling pathway
    103663832 (IL4)
   04658 Th1 and Th2 cell differentiation
    103663832 (IL4)
   04659 Th17 cell differentiation
    103663832 (IL4)
   04657 IL-17 signaling pathway
    103663832 (IL4)
   04664 Fc epsilon RI signaling pathway
    103663832 (IL4)
   04672 Intestinal immune network for IgA production
    103663832 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663832 (IL4)
  09163 Immune disease
   05310 Asthma
    103663832 (IL4)
   05320 Autoimmune thyroid disease
    103663832 (IL4)
   05321 Inflammatory bowel disease
    103663832 (IL4)
   05330 Allograft rejection
    103663832 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103663832 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103663832 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103663832 (IL4)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interleukins
   103663832 (IL4)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Haparin
  Cytokines
   103663832 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 103663832
NCBI-ProteinID: XP_008689855
UniProt: A0A384C641
LinkDB
Position
Un
AA seq 132 aa
MGLTSQLIPALVCLLALTSTFVHGHNFSITIKEIIKTLNILTARNDTCMELTVTNIFAAP
KNTTDTETFCRATTVLRQLSTHSCSNKLLGGLHRNLKTMANMTCSVNEVKKSTLRDFLER
LKAIVQRKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccagctctggtctgcttactagcactcaccagcacc
ttcgtccacggccataacttcagtattaccattaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgacacgtgcatggagctgaccgtcaccaacatcttcgctgcccca
aagaacacaactgatacggaaaccttctgcagagccacaactgtgcttcggcagctctct
acacacagctgctccaacaaactcctcggagggcttcacaggaacctcaagacaatggca
aacatgacctgttcggtgaatgaagtcaagaagagtacgctgagagacttcttggaaagg
ctaaaagcgatcgtgcaaaggaaatactacaggcactga

DBGET integrated database retrieval system