KEGG   Ursus maritimus (polar bear): 103663891
Entry
103663891         CDS       T03271                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04120  Ubiquitin mediated proteolysis
umr04530  Tight junction
umr04622  RIG-I-like receptor signaling pathway
umr04722  Neurotrophin signaling pathway
umr04912  GnRH signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103663891 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103663891 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103663891 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103663891 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103663891 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    103663891 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103663891 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103663891 (MAP3K1)
   05161 Hepatitis B
    103663891 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103663891 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:umr04121]
    103663891 (MAP3K1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103663891 (MAP3K1)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: STE group
  STE11 family
   103663891 (MAP3K1)
Ubiquitin system [BR:umr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103663891 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 SWIM PHD APH Phostensin_N FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 103663891
NCBI-ProteinID: XP_008689900
UniProt: A0A384C687
LinkDB
Position
Un
AA seq 1358 aa
MKFTALQRMYVASGELGYSPPREVLVALIVREMENKETLKGLHKMDDRPEERMIREKLKA
TCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEIHNLATESQGEGPASTTSPAPKGRRSP
SPSSSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETNRRVNKV
MRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVMLRVFQLEPS
DPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTSTSSS
ENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLC
RSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPLAGSQRRSQESNFNLTHYGAQQIP
PAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGNSGSNG
RSSPSAGASSGSSQTSISGDVVEACCNVLSMVCGDPVYKVYVAALKTLRAMLVYTPCHSL
AERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVGREILKAGSIG
IGGIDYVLSCILGNQTESNNWQELLGIVSTDVSQAEPVEVRYKKLLSLLTFALQSIDNSH
SMVGKLSRRIYLSSARMVTAVPHVFSKLLEMLNVSSSTHFTRMRRRLMAIADEVEIAEAI
QLGVGDTLDGRHDSFLQASVPTSYPETTENSSLERTDHLEKTGKGLCATKLSANLEDITD
RLGSISVGLPSSTTIEQPKPMVQTKGRPHSQCLNTSPLSHHSPLMFPHLSTPSSSAPSAP
TGTGTDVSKHRPQGFIPCKIPSPSPQTQRKFSLQFQRNCSENRDSDKLSPIFTQSRPLPS
SNIHRPKPSRPIPGNTSKQGDASKNSMTLDLNSTAQCDDSFGSSSNSSNAVIPSDETVFT
PVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKDENDDTYKDDVNHN
QKCKEKMEAEEEAALAIAMAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAK
QPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREE
IRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLL
RGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIA
FMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIP
SHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgaagtttactgcattgcagcgcatgtacgtggcctctggagaacttggttattcacca
cccagggaagttttagtagctctaatcgttcgtgagatggagaataaagaaactctcaag
gggttgcacaagatggatgatcgcccagaagaacgaatgatcagggagaaactgaaggca
acctgtatgccagcctggaagcatgagtggctggaaaggagaaataggagaggccctgtg
gtggtaaaaccaatccctattaaaggagatggttctgaaattcacaacttggcaactgag
tctcaaggagagggcccggcgagcaccacgtcacccgctcccaaaggccgacgcagtcct
tctcctagcagctccccatcaggtcgcacagtgaagtcggaatctccgggagttcggaga
aaaagagtttccccagtgccttttcagagtgggcgaatcacaccacctcgaagagcccct
tcaccggatggcttctcaccatacagccctgaggagacaaaccgccgtgtaaacaaagtt
atgcgggccaggctgtacttactgcaacaaataggacccaactctttcctgattggagga
gacagcccagataataaataccgggtgtttatcgggcctcagaactgcagctgtgggcgt
ggaacattttgtattcatctgttgtttgttatgcttcgggtgtttcaactagaaccttca
gacccgatgttatggagaaaaactttaaagaattttgaggttgaaagtttgttccagaaa
tatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatccagaagttt
gtttcacgcatgtcaaattctcatacattgtcatcatctagtacttctacatctagttca
gaaaacagtataaaagatgaggaggaacagatgtgtcctatttgcttgctgggcatgctt
gatgaagagagtctcaccgtgtgcgaagacggctgcaggaacaagctacatcaccactgc
atgtcaatctgggcagaagaatgtagaagaaatagagaacctttaatatgtcccctttgt
aggtctaagtggagatctcatgatttctatagccacgagttgtcaagccccgtggattcc
ccttcttccctgagagctgcacagcagcaaaccatacagcagcagcctttggctggatca
caacgaaggagtcaggagagcaattttaaccttactcattatggagctcagcagattcct
cctgcttacaaagatttagctgagccatggattcaggtatttggaatggaactcgttggc
tgcttattttctagaaactggaatgtaagagagatggctctcaggcgtctttcccacgat
gttagtggggctctgctattggcaaatggggagagcactggaaattctgggagcaacggt
agaagcagcccgagtgctggagccagcagtgggtcttcccagaccagtatctcaggagac
gtggtagaggcatgctgcaacgttttgtccatggtctgtggtgaccctgtctacaaagtg
tacgttgctgctttaaaaacgttgagagccatgctagtatatactccttgccatagtttg
gcagaaagaatcaaactgcagagacttctccggcctgttgtagacaccatcctagtgaag
tgtgcagatgccaatagtcgtacaagtcagctgtctatatcaacactgttggaattatgc
aaaggccaagcaggagagttggcagttggcagagaaatacttaaagctggatccattggt
attggtggtattgattatgtcttaagttgtattcttggaaaccaaacagaatcaaacaac
tggcaagaacttctgggtattgtcagtactgatgtttcacaagctgagcctgttgaagtc
aggtataaaaagctgctgtcccttttaacctttgctttgcagtccattgataattcccac
tcaatggttggtaaactctcccggaggatatatttgagttctgcaagaatggttactgca
gtaccccacgtattttcaaaactattagaaatgctgaatgtttccagttccactcatttt
accaggatgcgtcgtcgtctgatggctattgcagatgaggtggaaattgctgaggccatc
cagctgggcgtaggagacactttggatggtcgacatgacagctttttgcaggcatctgtc
cctaccagctatccagaaaccacagagaacagctcccttgagcgcacagaccatttagag
aaaactggaaaaggactgtgtgctacaaaacttagtgccaatttggaggacattactgac
agactgggcagcatttcagtaggacttcccagttcaacaacaatagagcaaccaaagcca
atggttcaaacaaaaggcagaccccacagtcagtgtttgaacacctctcctttatctcat
cattccccattaatgtttccacacttgtcaactccttcttcatctgccccctctgcacca
actggcactggaacagatgtctctaagcatagacctcagggattcattccctgcaaaata
ccttcgccatctcctcaaacacagcgcaagttttctctacagttccagagaaactgttct
gaaaacagagactcagataaactttcccccatctttactcagtcaagacccctgccctct
agtaatatacacaggccaaagccatctcgacctatcccaggtaatacaagtaaacaggga
gatgcctcaaagaacagcatgacacttgatctgaacagtactgcccaatgtgatgacagc
tttggcagcagcagcaacagcagtaatgctgtcatacccagtgatgagacagtgttcacc
ccagtagaagagaaatgcagattagatgtcaatacagagctcaactccagtattgaggac
cttcttgaagcatctatgccttcaagtgacacaacagtaacttttaagtcagaagttgct
gtactctctcctgaaaaggatgaaaatgatgatacctacaaagatgatgtgaatcataat
cagaaatgcaaagaaaagatggaagctgaagaagaagcagctttagcaattgccatggca
atgtcagcgtctcaggatgcccttcccatagttcctcaactacaagttgaaaatggagaa
gatatcatcatcattcaacaggatacaccagaaactctaccaggacataccaaagcaaaa
cagccttacagagaagacactgaatggctgaaaggtcagcagataggccttggagcattt
tcttcctgttaccaggctcaagatgtgggaactggaactttaatggctgttaaacaggtg
acatatgtcagaaatacatcttctgagcaagaagaagtagtggaagcattaagagaagag
atcagaatgatgagccatttgaatcatcccaacatcattaggatgttgggagccacatgt
gagaagagcaattacaatctcttcatcgaatggatggcagggggatctgtggctcatttg
ctcagtaaatatggagccttcaaggaatcagtagttattaactatactgaacaattactt
cgtggcctttcgtatctccatgaaaaccagatcattcatagagatgtcaaaggtgccaat
ttgctaattgacagcacaggtcagagactgagaattgcagattttggagctgcagcgagg
ttggcatcaaaaggaactggtgctggagagtttcagggacagttattggggacaattgca
tttatggcacctgaggtactaagaggtcagcagtatggtaggagctgtgatgtatggagt
gttggctgtgccattatagaaatggcttgtgctaaaccaccttggaacgcagaaaaacac
tccaatcatcttgctttgatatttaagattgcaagtgcgactactgctccatcgatccct
tcacatttgtctcctggtttacgagatgtagctcttcggtgtttagaacttcaacctcag
gacagacctccatcaagagagctactgaagcatccagtcttccgtactacgtggtag

DBGET integrated database retrieval system